• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated SOX2 Polyclonal antibody

Proteintech has an extensive range of SOX2 antibodies validated forWB, IHC, IF/ICC, IF-P, FC (Intra), CoIP, ELISA and more.
Cat No. CL594-11064

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, zebrafish

Applications

IF-P

Transcription factor SOX-2, Transcription factor SOX 2, SOX 2, MCOPS3, MCOPS 3

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF-P detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 1 publications below

Product Information

CL594-11064 targets SOX2 in IF-P applications and shows reactivity with human, mouse, rat, zebrafish samples.

Tested Reactivity human, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1530

Product name: Recombinant human SOX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 59-118 aa of BC013923

Sequence: MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT

Predict reactive species
Full Name SRY (sex determining region Y)-box 2
Calculated Molecular Weight 34 kDa
Observed Molecular Weight 34-40 kDa
GenBank Accession NumberBC013923
Gene Symbol SOX2
Gene ID (NCBI) 6657
RRIDAB_2919758
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP48431
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Background

SRY (sex determining region Y)-box 2 is a transcription factor involved in neural stem cell maintenance and has been used in somatic cell reprogramming.

 What is the molecular weight of Sox2?

34 kDa. Sox2 is an intronless gene encoding xx amino acids including HMG (High-mobility group) box domains that can bind to DNA.

 What is the tissue specificity of Sox2?

In embryonic stem cells, Sox2 is highly expressed and is essential in self-renewal. In the developing embryo, Sox2 is found in the neural tube and then in the developing eye and central nervous system (CNS). This expression is highly conserved across organisms (PMID: 25126380; PMID: 8625802).

In adult tissues Sox2 is expressed in neural progenitor cells, which as multipotent cells can both self-renew and differentiate into neurons, astroglia, and oligodendroglia. It maintains their stem cell phenotype and is a useful marker of early neural stem cells (PMID: 16139372).

 What is the role of Sox2 in pluripotency?

Sox2 acts as part of the LIF (Leukemia inhibitory factor) pathway, activated via JAK-STAT signaling to form complexes with other transcription factors such as Oct4 that bind to DNA and work to control pluripotency. Sox2 was described as one of the four original factors that are key to the reprogramming of somatic cells to induced pluripotent stem cells (iPSCs) (PMID: 16904174).

 What is the role of Sox2 in cancer?

The ability to control pluripotency means dysregulation of Sox2 can lead to uncontrolled proliferation. In many different cancers, Sox2 has been associated with the metastasis and growth of tumors, mostly due to overexpression (PMID: 28388544). The increased levels of Sox2 RNA and protein in tumor tissue highlight it as a potential therapeutic target (PMID: 25114775).


Protocols

Product Specific Protocols
IF protocol for CL594 SOX2 antibody CL594-11064Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
IF

J Integr Neurosci

Alterations in Endogenous Stem Cell Populations in the Acute Phase of Blast-Induced Spinal Cord Injury

Authors - David Valenti
Loading...
||
New chat Able
正在加载,请稍候...