Tested Applications
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IF | See 1 publications below |
Product Information
CL594-11064 targets SOX2 in IF-P applications and shows reactivity with human, mouse, rat, zebrafish samples.
| Tested Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1530 Product name: Recombinant human SOX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 59-118 aa of BC013923 Sequence: MAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKT Predict reactive species |
| Full Name | SRY (sex determining region Y)-box 2 |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 34-40 kDa |
| GenBank Accession Number | BC013923 |
| Gene Symbol | SOX2 |
| Gene ID (NCBI) | 6657 |
| RRID | AB_2919758 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P48431 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Background
SRY (sex determining region Y)-box 2 is a transcription factor involved in neural stem cell maintenance and has been used in somatic cell reprogramming.
What is the molecular weight of Sox2?
34 kDa. Sox2 is an intronless gene encoding xx amino acids including HMG (High-mobility group) box domains that can bind to DNA.
What is the tissue specificity of Sox2?
In embryonic stem cells, Sox2 is highly expressed and is essential in self-renewal. In the developing embryo, Sox2 is found in the neural tube and then in the developing eye and central nervous system (CNS). This expression is highly conserved across organisms (PMID: 25126380; PMID: 8625802).
In adult tissues Sox2 is expressed in neural progenitor cells, which as multipotent cells can both self-renew and differentiate into neurons, astroglia, and oligodendroglia. It maintains their stem cell phenotype and is a useful marker of early neural stem cells (PMID: 16139372).
What is the role of Sox2 in pluripotency?
Sox2 acts as part of the LIF (Leukemia inhibitory factor) pathway, activated via JAK-STAT signaling to form complexes with other transcription factors such as Oct4 that bind to DNA and work to control pluripotency. Sox2 was described as one of the four original factors that are key to the reprogramming of somatic cells to induced pluripotent stem cells (iPSCs) (PMID: 16904174).
What is the role of Sox2 in cancer?
The ability to control pluripotency means dysregulation of Sox2 can lead to uncontrolled proliferation. In many different cancers, Sox2 has been associated with the metastasis and growth of tumors, mostly due to overexpression (PMID: 28388544). The increased levels of Sox2 RNA and protein in tumor tissue highlight it as a potential therapeutic target (PMID: 25114775).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 SOX2 antibody CL594-11064 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

