Recombinant human SPINK1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag17131
Synonyms
SPINK1, PCTT, PSTI, Serine protease inhibitor Kazal-type 1, Spink3
Validation Data Gallery View All
Product Information
| Peptide Sequence |
DSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC
(24-79 aa encoded by BC025790) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
