SPRY4 Polyclonal antibody

• 

  WB analysis of A375 using 22765-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 22765-1-AP (SPRY4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse liver using 22765-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 22765-1-AP (SPRY4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 22765-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 22765-1-AP (SPRY4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

SPRY4 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 22765-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF, ELISA

Synonyms

Spry-4, Spry 4, sprouty homolog 4 (Drosophila), Protein sprouty homolog 4, HH17

---

Tested Applications

• Positive WB detected in: A375 cells
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 6 publications below
• WB: See 5 publications below
• IHC: See 3 publications below
• IF: See 1 publications below

Product Information

22765-1-AP targets SPRY4 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18574

  Product name: Recombinant human SPRY4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-165 aa of BC125095

  Sequence: MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLALTTGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACGKC

• Full Name: sprouty homolog 4 (Drosophila)
• Calculated Molecular Weight: 299 aa, 33 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC125095
• Gene Symbol: SPRY4
• Gene ID (NCBI): 81848
• RRID: AB_2879163
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9C004
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPRY4, also named as Protein sprouty homolog 4, is a 299 amino acid protein, which contains one SPR (sprouty) domain and belongs to the sprouty family. SPRY4 Suppresses the INS receptor and EGFR-transduced MAPK signaling pathway, but does not inhibit MAPK activation by a constitutively active mutant Ras. Probably impairs the formation of GTP-Ras. SPRY4 has a cellular function to regulate the actin cytoskeleton, independent of its inhibitory activity on the Ras/MAP kinase signalling. SPRY1, SPRY2, SPRY3, SPRY4, are central and complex regulators of the receptor tyrosine kinase (RTK) signalling pathway.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Clin Invest; Targeting enhancer reprogramming to mitigate MEK inhibitor resistance in preclinical models of advanced ovarian cancer.; Authors - Shini Liu ; KD Validated
human	IHC	Cancer Lett; Coupling HDAC4 with transcriptional factor MEF2D abrogates SPRY4-mediated suppression of ERK activation and elicits hepatocellular carcinoma drug resistance.; Authors - Qingxia Ma ; KO Validated
human	WB,IHC,IF	Am J Reprod Immunol; SPRY4 regulates trophoblast proliferation and apoptosis via regulating IFN-γ-induced STAT1 expression and activation in recurrent miscarriage.; Authors - Shi Qin ; KD Validated
human	WB,IHC	Cell Death Dis; SPRY4 is responsible for pathogenesis of adolescent idiopathic scoliosis by contributing to osteogenic differentiation and melatonin response of bone marrow-derived mesenchymal stem cells.; Authors - Jing Li ; KD Validated
human	WB	Nat Commun; AXL confers intrinsic resistance to osimertinib and advances the emergence of tolerant cells.; Authors - Hirokazu Taniguchi ; KD Validated
human	WB	Adipocyte; SPRY4 promotes adipogenic differentiation of human mesenchymal stem cells through the MEK-ERK1/2 signaling pathway; Authors - Na Li ; KD Validated