SREBF1 Polyclonal antibody

• 

  WB analysis using 14088-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14088-1-AP (SREBF1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14088-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14088-1-AP (SREBF1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14088-1-AP

  WB result of SREBF1 antibody (14088-1-AP; 1:6000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SREBF1 transfected HeLa cells.

• 

  WB analysis of HeLa using 14088-1-AP

  WB result of SREBF1 antibody (14088-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-SREBF1 transfected HeLa cells.

• 

  WB analysis using 14088-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14088-1-AP (SREBF1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14088-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14088-1-AP (SREBF1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 14088-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 14088-1-AP (SREBF1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14088-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14088-1-AP (SREBF1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of L02 using 14088-1-AP

  IP result of anti-SREBF1 (IP:14088-1-AP, 4ug; Detection:14088-1-AP 1:600) with L02 cells lysate 1500ug.

• 

  IHC staining of human kidney using 14088-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14088-1-AP (SREBF1 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 14088-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 14088-1-AP (SREBF1 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human skeletal muscle using 14088-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 14088-1-AP (SREBF1 Antibody) at dilution of 1:25 (under 10x lens).

• 

  IHC staining of human skeletal muscle using 14088-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 14088-1-AP (SREBF1 Antibody) at dilution of 1:25 (under 40x lens).

• 

  IF Staining of HeLa using 14088-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 14088-1-AP (SREBF1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

SREBF1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14088-1-AP

Publications(289)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

Synonyms

SREBP 1c, SREBP 1, SREBF 1, Processed sterol regulatory element-binding protein 1, Class D basic helix-loop-helix protein 1

---

Tested Applications

• Positive WB detected in: HeLa cells, L02 cells, MCF-7 cells, mouse liver tissue, rat liver tissue
• Positive IP detected in: L02 cells
• Positive IHC detected in: human kidney tissue, human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 10 publications below
• WB: See 259 publications below
• IHC: See 34 publications below
• IF: See 29 publications below
• IP: See 2 publications below
• CoIP: See 2 publications below
• ChIP: See 7 publications below

Product Information

14088-1-AP targets SREBF1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, monkey, chicken, bovine, sheep, goat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5219

  Product name: Recombinant human SREBF1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-332 aa of BC063281

  Sequence: MDEPPFSEAALEQALGEPCDLDAALLTDIEGEVGAGRGRANGLDAPRAGADRGAMDCTFEDMLQLINNQDSDFPGLFDPPYAGSGAGGTDPASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGPGIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGNTQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLLQPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDAEK

• Full Name: sterol regulatory element binding transcription factor 1
• Calculated Molecular Weight: 1177 aa, 125 kDa
• Observed Molecular Weight: 125 kDa, 68 kDa
• GenBank Accession Number: BC063281
• Gene Symbol: SREBF1
• Gene ID (NCBI): 6720
• RRID: AB_2255217
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P36956
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SREBF1, also named as BHLHD1 and SREBP1, contains one basic helix-loop-helix (bHLH) domain and belongs to the SREBP family. It is a transcriptional activator required for lipid homeostasis. The SREBPs are synthesized as precursors anchored to endoplasmic reticulum (ER) membranes and complexed with SCAP. When the cellular cholesterol level is low, SREBP-SCAP complexes move to the Golgi apparatus, where SREBPs undergo a two-step proteolytic processing, leading to the release of the mature form, an N-terminal fragment, i.e, basic helix-loop-helix leucine zipper transcription factor. These factors enter the nucleus where they bind to sterol regulatory elements (SRE) in the promoter regions of a number of genes whose products mediate the synthesis of cholesterol and fatty acids. [PMID: 21698267]. This antibody can recognize the 125 kDa precursor form and the 68 kDa mature form of human SREBF1.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Cell; KMT2C deficiency drives transdifferentiation of double-negative prostate cancer and confer resistance to AR-targeted therapy; Authors - Jiacheng Guo
human	WB	Nature; A metastasis map of human cancer cell lines.; Authors - Xin Jin ; KO Validated
mouse	IHC	Nature; Divergent transcriptional regulation of astrocyte reactivity across disorders.; Authors - Joshua E Burda
human	WB	Cell Metab; CircACC1 Regulates Assembly and Activation of AMPK Complex under Metabolic Stress.; Authors - Qidong Li ; KD Validated
mouse	IHC	Cell Metab; TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis.; Authors - Dong Huang
mouse	WB	Nat Commun; Senescence-associated 13-HODE production promotes age-related liver steatosis by directly inhibiting catalase activity; Authors - Jinjie Duan

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Isha (Verified Customer) (05-18-2022)

Antibody worked perfect at 1:1000 dilution for W.B. and 1:500 for IF. And for chIP 3ug/ml worked best.

• Applications: Western Blot, Immunofluorescence, ChIP