Tested Applications
| Positive WB detected in | HUVEC cells, HepG2 cells, PC-3 cells, HeLa cells |
| Positive IP detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28212-1-AP targets SREBF2 in WB, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, hamster, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28205 Product name: Recombinant human SREBF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 375-479 aa of BC056158 Sequence: DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR Predict reactive species |
| Full Name | sterol regulatory element binding transcription factor 2 |
| Calculated Molecular Weight | 124 kDa |
| Observed Molecular Weight | 73-75 kDa, 120-130 kDa |
| GenBank Accession Number | BC056158 |
| Gene Symbol | SREBF2 |
| Gene ID (NCBI) | 6721 |
| RRID | AB_2881091 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12772 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SREBF2,also named as BHLHD2, is a 1141 amino acid protein, which contains 1 bHLH domain and belongs to the SREBP family. SREBF2 localizes in the endoplasmic reticulum membrane and is ubiquitously expressed in adult and fetal tissues. SREBF2 as a transcriptional activator is required for lipid homeostasis. SREBF2 expression is dynamically regulated in response to nutritional and hormonal cues. SREBF2 exists two isoform with molecular weight 124 kDa and 73 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for SREBF2 antibody 28212-1-AP | Download protocol |
| WB protocol for SREBF2 antibody 28212-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The anti-SREBP antibody (Cat# 28212-1-AP) has 107 citations published in journals including Nature, Cell, Cancer Cell, Nat Commun, Adv Sci, Cell Death & Disease, Mol Cell, Cell Reports, Phytomedicine, FASEB J, and many others. Associated research fields encompass lipid/cholesterol metabolism, oncology (hepatocellular, colorectal, breast, prostate, ovarian cancers), atherosclerosis, NAFLD/NASH, ferroptosis, pyroptosis, diabetes, obesity, cardiovascular disease, neurodegeneration, and viral infections.
| Species | Application | Title |
|---|---|---|
Cancer Cell Targeting the mevalonate pathway suppresses ARID1A-inactivated cancers by promoting pyroptosis | ||
Cancer Commun (Lond) PTPRO represses colorectal cancer tumorigenesis and progression by reprogramming fatty acid metabolism. | ||
Cancer Res Spatial Multiomics Analyses Reveal That Diabetes Promotes Pancreatic Cancer Progression by Stimulating Cholesterol-Induced Neutrophil Extracellular Trap Formation.
| ||
Nat Commun The p97-UBXD8 complex regulates ER-Mitochondria contact sites by altering membrane lipid saturation and composition |
Reviews
What customers say
Overall reviews are mixed to negative. One user reported good performance in Jurkat cells, detecting both precursor and mature SREBF2. However, multiple reviewers noted significant specificity concerns, with many non-specific bands and difficulty identifying the expected ~130 kDa band. One reviewer observed the uncleaved form appearing in nuclear fractions, which was unexpected. Another found a specific but weak band at ~150 kDa rather than the stated 130 kDa. Most negative feedback centered on poor signal-to-noise ratio across different cell types and tissues tested.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Simon (Verified Customer) (07-23-2025) | The antibody works well for Jurkat cells, showin the precursor and the mature SREBF2
 |
Shunbin (Verified Customer) (05-14-2024) | Not good. Only non specific bands detected
 |
Shunbin (Verified Customer) (05-14-2024) | Many non specific bands, but no specific band can be identified
 |
Bertrand (Verified Customer) (04-08-2024) | This is a Srebp2 antibody, however, the results from western blot analysis show that the product might not be specific to Srebf2...There are lots of non-specific bands and the uncleaved/immature protein should not be present in the nucleus of cells, yet it was there.
|
Boyan (Verified Customer) (04-17-2023) | OK for WB, a specific but weak band was seen around 150 kd, but not 130 kd, which is shown on its booklet. The 130 kd band is a strong nonspecific band.
|
