Tested Applications
| Positive WB detected in | HUVEC cells, HepG2 cells, PC-3 cells, HeLa cells |
| Positive IP detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 8 publications below |
| WB | See 66 publications below |
| CoIP | See 1 publications below |
Product Information
28212-1-AP targets SREBF2 in WB, IP, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat, pig, hamster, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28205 Product name: Recombinant human SREBF2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 375-479 aa of BC056158 Sequence: DYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDNEVDLKIEDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVALGMVDR Predict reactive species |
| Full Name | sterol regulatory element binding transcription factor 2 |
| Calculated Molecular Weight | 124 kDa |
| Observed Molecular Weight | 73-75 kDa, 120-130 kDa |
| GenBank Accession Number | BC056158 |
| Gene Symbol | SREBF2 |
| Gene ID (NCBI) | 6721 |
| RRID | AB_2881091 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12772 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SREBF2,also named as BHLHD2, is a 1141 amino acid protein, which contains 1 bHLH domain and belongs to the SREBP family. SREBF2 localizes in the endoplasmic reticulum membrane and is ubiquitously expressed in adult and fetal tissues. SREBF2 as a transcriptional activator is required for lipid homeostasis. SREBF2 expression is dynamically regulated in response to nutritional and hormonal cues. SREBF2 exists two isoform with molecular weight 124 kDa and 73 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IP protocol for SREBF2 antibody 28212-1-AP | Download protocol |
| WB protocol for SREBF2 antibody 28212-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cancer Cell Targeting the mevalonate pathway suppresses ARID1A-inactivated cancers by promoting pyroptosis | ||
Redox Biol Lipophagy-mediated cholesterol synthesis inhibition is required for the survival of hepatocellular carcinoma under glutamine deprivation
| ||
Hypertension Statins Prevent the Deleterious Consequences of Placental Chemerin Upregulation in Preeclampsia | ||
Acta Pharmacol Sin Urolithin A promotes atherosclerotic plaque stability by limiting inflammation and hypercholesteremia in Apolipoprotein E-deficient mice | ||
Mol Metab CD36 promotes de novo lipogenesis in hepatocytes through INSIG2-dependent SREBP1 processing. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Simon (Verified Customer) (07-23-2025) | The antibody works well for Jurkat cells, showin the precursor and the mature SREBF2
|
FH Shunbin (Verified Customer) (05-14-2024) | Not good. Only non specific bands detected
![]() |
FH Shunbin (Verified Customer) (05-14-2024) | Many non specific bands, but no specific band can be identified
![]() |
FH Bertrand (Verified Customer) (04-08-2024) | This is a Srebp2 antibody, however, the results from western blot analysis show that the product might not be specific to Srebf2...There are lots of non-specific bands and the uncleaved/immature protein should not be present in the nucleus of cells, yet it was there.
|
FH Boyan (Verified Customer) (04-17-2023) | OK for WB, a specific but weak band was seen around 150 kd, but not 130 kd, which is shown on its booklet. The 130 kd band is a strong nonspecific band.
|









