STK25 Polyclonal antibody

• 

  WB analysis using 25821-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25821-1-AP (STK25 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25821-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25821-1-AP (STK25 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Neuro-2a using 25821-1-AP

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 25821-1-AP (STK25 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 25821-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25821-1-AP (STK25 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 25821-1-AP

  IP result of anti-STK25 (IP:25821-1-AP, 4ug; Detection:25821-1-AP 1:4000) with mouse brain tissue lysate 1840 ug.

• Featured Product
• KD/KO Validated

STK25 Polyclonal Antibody for WB, IP, ELISA

Cat No. 25821-1-AP

Publications(8)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

Ste20 like kinase, SOK-1, SOK1, SOK 1, Serine/threonine-protein kinase 25

---

Tested Applications

• Positive WB detected in: Neuro-2a cells, HepG2 cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 7 publications below
• IP: See 1 publications below

Product Information

25821-1-AP targets STK25 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22964

  Product name: Recombinant human STK25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 323-426 aa of BC015793

  Sequence: PTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHEQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR

• Full Name: serine/threonine kinase 25 (STE20 homolog, yeast)
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC015793
• Gene Symbol: STK25
• Gene ID (NCBI): 10494
• RRID: AB_2880255
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00506
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Signal Transduct Target Ther; The AKAP12-PKA axis regulates lipid homeostasis during alcohol-associated liver disease; Authors - Chandana Thimme Gowda
mouse	IP	Cell Mol Gastroenterol Hepatol; Targeted Delivery of Stk25 Antisense Oligonucleotides to Hepatocytes Protects Mice Against Nonalcoholic Fatty Liver Disease.; Authors - Emmelie Cansby
human,mouse	WB	Cell Mol Gastroenterol Hepatol; Antagonizing STK25 Signaling Suppresses the Development of Hepatocellular Carcinoma Through Targeting Metabolic, Inflammatory, and Pro-Oncogenic Pathways.; Authors - Yeshwant Kurhe ; KD Validated
human	WB	J Exp Clin Cancer Res; STK25-induced inhibition of aerobic glycolysis via GOLPH3-mTOR pathway suppresses cell proliferation in colorectal cancer.; Authors - Fan Wu ; KD Validated
human	WB	Mol Carcinog; Downregulation of STK25 promotes autophagy via the Janus kinase 2/signal transducer and activator of transcription 3 pathway in colorectal cancer.; Authors - Jiangbo Chen
rat	WB	Cell Mol Neurobiol; Lanthanum Chloride Induces Axon Abnormality Through LKB1-MARK2 and LKB1-STK25-GM130 Signaling Pathways.; Authors - Zeli Song