STK25 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• STK25 Polyclonal antibody (25821-1-AP)

• Featured Product
• KD/KO Validated

STK25 Polyclonal Antibody for WB, IP, ELISA

Cat No. 25821-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

EC:2.7.11.1, Serine/threonine-protein kinase 25, SOK 1, SOK1, SOK-1

• 

  WB analysis using 25821-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25821-1-AP (STK25 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 25821-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25821-1-AP (STK25 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 25821-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 25821-1-AP (STK25 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Neuro-2a using 25821-1-AP

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 25821-1-AP (STK25 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 25821-1-AP

  IP result of anti-STK25 (IP:25821-1-AP, 4ug; Detection:25821-1-AP 1:4000) with mouse brain tissue lysate 1840 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for STK25 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Neuro-2a cells, HepG2 cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25821-1-AP targets STK25 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22964

  Product name: Recombinant human STK25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 323-426 aa of BC015793

  Sequence: PTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHEQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR

• Full Name: serine/threonine kinase 25 (STE20 homolog, yeast)
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC015793
• Gene Symbol: STK25
• Gene ID (NCBI): 10494
• RRID: AB_2880255
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00506
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-STK25 antibody (Cat# 25821-1-AP) has 10 citations across 8 journals, including Signal Transduction and Targeted Therapy, Journal of Experimental & Clinical Cancer Research, Cell Molecular Gastroenterology and Hepatology, Cell and Molecular Neurobiology, Molecular Carcinogenesis, Biochemical and Biophysical Research Communications, Oncology Letters, and Molecular Therapy Nucleic Acids. Research fields span liver disease (NAFLD/MASLD, HCC), colorectal cancer, metabolic regulation, lipid homeostasis, autophagy, and neurobiology.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Signal Transduct Target Ther; The AKAP12-PKA axis regulates lipid homeostasis during alcohol-associated liver disease; Authors - Chandana Thimme Gowda
human	WB	J Exp Clin Cancer Res; STK25-induced inhibition of aerobic glycolysis via GOLPH3-mTOR pathway suppresses cell proliferation in colorectal cancer.; Authors - Fan Wu ; KD Validated
mouse,human	WB	Cell Mol Gastroenterol Hepatol; Therapeutic Potential of STE20-Type Kinase STK25 Inhibition for the Prevention and Treatment of Metabolically Induced Hepatocellular Carcinoma; Authors - Ying Xia ; KO Validated
mouse	IP	Cell Mol Gastroenterol Hepatol; Targeted Delivery of Stk25 Antisense Oligonucleotides to Hepatocytes Protects Mice Against Nonalcoholic Fatty Liver Disease.; Authors - Emmelie Cansby
mouse,human	WB	Cell Mol Gastroenterol Hepatol; Antagonizing STK25 Signaling Suppresses the Development of Hepatocellular Carcinoma Through Targeting Metabolic, Inflammatory, and Pro-Oncogenic Pathways.; Authors - Yeshwant Kurhe ; KD Validated
rat	WB	Cell Mol Neurobiol; Lanthanum Chloride Induces Axon Abnormality Through LKB1-MARK2 and LKB1-STK25-GM130 Signaling Pathways.; Authors - Zeli Song