Tested Applications
Positive WB detected in | Neuro-2a cells, HepG2 cells, mouse brain tissue, rat brain tissue |
Positive IP detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:10000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 4 publications below |
WB | See 7 publications below |
IP | See 1 publications below |
Product Information
25821-1-AP targets STK25 in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22964 Product name: Recombinant human STK25 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 323-426 aa of BC015793 Sequence: PTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHEQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR Predict reactive species |
Full Name | serine/threonine kinase 25 (STE20 homolog, yeast) |
Calculated Molecular Weight | 48 kDa |
Observed Molecular Weight | 48 kDa |
GenBank Accession Number | BC015793 |
Gene Symbol | STK25 |
Gene ID (NCBI) | 10494 |
RRID | AB_2880255 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O00506 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for STK25 antibody 25821-1-AP | Download protocol |
IP protocol for STK25 antibody 25821-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Signal Transduct Target Ther The AKAP12-PKA axis regulates lipid homeostasis during alcohol-associated liver disease | ||
Cell Mol Gastroenterol Hepatol Targeted Delivery of Stk25 Antisense Oligonucleotides to Hepatocytes Protects Mice Against Nonalcoholic Fatty Liver Disease. | ||
Cell Mol Gastroenterol Hepatol Antagonizing STK25 Signaling Suppresses the Development of Hepatocellular Carcinoma Through Targeting Metabolic, Inflammatory, and Pro-Oncogenic Pathways.
| ||
J Exp Clin Cancer Res STK25-induced inhibition of aerobic glycolysis via GOLPH3-mTOR pathway suppresses cell proliferation in colorectal cancer.
| ||
Mol Carcinog Downregulation of STK25 promotes autophagy via the Janus kinase 2/signal transducer and activator of transcription 3 pathway in colorectal cancer. | ||
Cell Mol Neurobiol Lanthanum Chloride Induces Axon Abnormality Through LKB1-MARK2 and LKB1-STK25-GM130 Signaling Pathways. |