Tested Applications
Positive IHC detected in | mouse testis tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
Biotin-25821 targets STK25 in IHC applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22964 Product name: Recombinant human STK25 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 323-426 aa of BC015793 Sequence: PTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHEQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR Predict reactive species |
Full Name | serine/threonine kinase 25 (STE20 homolog, yeast) |
Calculated Molecular Weight | 48 kDa |
Observed Molecular Weight | 48 kDa |
GenBank Accession Number | BC015793 |
Gene Symbol | STK25 |
Gene ID (NCBI) | 10494 |
RRID | AB_2918942 |
Conjugate | Biotin |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O00506 |
Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for Biotin STK25 antibody Biotin-25821 | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |