Biotin-conjugated STK25 Polyclonal antibody

• 

  IHC staining of mouse testis using Biotin-25821

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using Biotin-25821 (STK25 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using Biotin-25821

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using Biotin-25821 (STK25 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using Biotin-25821

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using Biotin-25821 (STK25 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using Biotin-25821

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using Biotin-25821 (STK25 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using Biotin-25821

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using Biotin-25821 (STK25 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using Biotin-25821

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using Biotin-25821 (STK25 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

STK25 Polyclonal Antibody for IHC

Cat No. Biotin-25821

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC

Synonyms

DKFZp686J1430, SOK 1, SOK1, Ste20 like kinase, STK25, YSK1

---

Tested Applications

• Positive IHC detected in: mouse testis tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-25821 targets STK25 in IHC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22964

  Product name: Recombinant human STK25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 323-426 aa of BC015793

  Sequence: PTIRPSPHSKLHKGTALHSSQKPAEPVKRQPRSQCLSTLVRPVFGELKEKHEQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRNHLTSTR

• Full Name: serine/threonine kinase 25 (STE20 homolog, yeast)
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC015793
• Gene Symbol: STK25
• Gene ID (NCBI): 10494
• RRID: AB_2918942
• Conjugate: Biotin
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00506
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.