• Featured Product
  • KD/KO Validated

MST1 Monoclonal antibody

MST1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 66663-1-Ig
Clone No.2G11C1

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

MST2, STK4, STK4/MST1, 2G11C1, EC:2.7.11.1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, RAW 264.7 cells
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPC-3 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66663-1-Ig targets MST1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17738

Product name: Recombinant human STK4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 383-451 aa of BC093768

Sequence: RRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLAL

Predict reactive species
Full Name serine/threonine kinase 4
Calculated Molecular Weight 487 aa, 56 kDa
Observed Molecular Weight 52-56 kDa
GenBank Accession NumberBC093768
Gene Symbol MST1
Gene ID (NCBI) 6789
RRIDAB_2882018
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13043
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mammalian STE20-like serine-threonine kinase MST1, encoded by the STK4 gene, is a multifunctional protein. MST1 and its closest paralogs MST2 (encoded by the STK3 gene), MST3, and MST4 are members of the Class II Germinal Center Family of Protein Kinases . STK3/4 and LATS1/2 (large tumor suppressor 1 and 2) are core kinase components of the Hippo tumor suppressor pathway in mammalians . In the conventional Hippo pathway, the STK3/4 and LATS1/2 signaling cascade phosphorylates and inactivates the transcriptional coactivator YAP1 (yes associated protein 1) and its close paralog WWTR1]. YAP1 and WWTR1 do not have DNA binding domains and they exert their biological outputs, such as cell proliferation and survival, by interacting with the TEAD1-4 transcription factors. Lines of evidence have indicated that dysregulation or loss of STK4/Hippo signaling is linked to developmental disorders and carcinogenesis with poor prognosis. STK4 is a stress-induced kinase and it can be activated in response to cell-death inducers. Autophosphorylation of STK4 at Thr183 (Thr180 in STK3) in the activation loop is a key activation mechanism for STK4/3 because phosphorylation of Thr183/180 causes the cleavage of STK4 by caspases under apoptotic conditions. The caspase-cleavage results in a more active STK4 protein (STK4-N, an amino-terminally truncated STK4), which localizes into the nucleus and induces apoptosis through histone modifications and chromatin condensations.

Protocols

Product Specific Protocols
IF protocol for MST1 antibody 66663-1-IgDownload protocol
IHC protocol for MST1 antibody 66663-1-IgDownload protocol
WB protocol for MST1 antibody 66663-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Biofactors

FERM domain-containing protein 6 exerts a tumor-inhibiting role in thyroid cancer by antagonizing oncogenic YAP1

Authors - Wei Wang
humanWB

J Biol Chem

Angiomotins stimulate LATS kinase autophosphorylation and act as scaffolds that promote Hippo signaling.

Authors - Sebastian Mana-Capelli
mouseIHC

J Endocr Soc

Effect of Inactivation of Mst1 and Mst2 in the Mouse Adrenal Cortex

Authors - Nour Abou Nader
human

Biochem Pharmacol

A humanized Anti-YKL-40 antibody inhibits tumor development

Authors - Haihui Yu
  • KD Validated
mouseWB

Br J Pharmacol

Diminished nuclear-localized β-adrenoceptor signalling activates YAP to promote kidney fibrosis in diabetic nephropathy

Authors - Wenjing Xiang
Loading...
||
New chat Able
正在加载,请稍候...