• Featured Product
  • KD/KO Validated

MST1 Monoclonal antibody, PBS Only

MST1 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA
Cat No. 66663-1-PBS
Clone No.2G11C1

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

MST2, STK4, STK4/MST1, 2G11C1, EC:2.7.11.1

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66663-1-PBS targets MST1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17738

Product name: Recombinant human STK4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 383-451 aa of BC093768

Sequence: RRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLAL

Predict reactive species
Full Name serine/threonine kinase 4
Calculated Molecular Weight 487 aa, 56 kDa
Observed Molecular Weight 52-56 kDa
GenBank Accession NumberBC093768
Gene Symbol MST1
Gene ID (NCBI) 6789
RRIDAB_2882018
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13043
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Mammalian STE20-like serine-threonine kinase MST1, encoded by the STK4 gene, is a multifunctional protein. MST1 and its closest paralogs MST2 (encoded by the STK3 gene), MST3, and MST4 are members of the Class II Germinal Center Family of Protein Kinases . STK3/4 and LATS1/2 (large tumor suppressor 1 and 2) are core kinase components of the Hippo tumor suppressor pathway in mammalians . In the conventional Hippo pathway, the STK3/4 and LATS1/2 signaling cascade phosphorylates and inactivates the transcriptional coactivator YAP1 (yes associated protein 1) and its close paralog WWTR1]. YAP1 and WWTR1 do not have DNA binding domains and they exert their biological outputs, such as cell proliferation and survival, by interacting with the TEAD1-4 transcription factors. Lines of evidence have indicated that dysregulation or loss of STK4/Hippo signaling is linked to developmental disorders and carcinogenesis with poor prognosis. STK4 is a stress-induced kinase and it can be activated in response to cell-death inducers. Autophosphorylation of STK4 at Thr183 (Thr180 in STK3) in the activation loop is a key activation mechanism for STK4/3 because phosphorylation of Thr183/180 causes the cleavage of STK4 by caspases under apoptotic conditions. The caspase-cleavage results in a more active STK4 protein (STK4-N, an amino-terminally truncated STK4), which localizes into the nucleus and induces apoptosis through histone modifications and chromatin condensations.

Loading...
||
New chat Able
正在加载,请稍候...