SYNJ2BP Polyclonal antibody

• Home
• Products
• Primary Antibodies
• SYNJ2BP Polyclonal antibody (15666-1-AP)

• Featured Product
• KD/KO Validated

SYNJ2BP Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 15666-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

ARIP2, OMP25, Synaptojanin-2-binding protein

• 

  WB analysis using 15666-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15666-1-AP (SYNJ2BP antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 15666-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 15666-1-AP (SYNJ2BP antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse lung using 15666-1-AP

  IP result of anti-SYNJ2BP (IP:15666-1-AP, 3ug; Detection:15666-1-AP 1:500) with mouse lung tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 15666-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15666-1-AP (SYNJ2BP antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 15666-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15666-1-AP (SYNJ2BP antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 15666-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using SYNJ2BP antibody (15666-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 15666-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using SYNJ2BP antibody (15666-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HepG2 using 15666-1-AP

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human SYNJ2BP (15666-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for SYNJ2BP in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, mouse kidney tissue, mouse lung tissue, rat kidney tissue
• Positive IP detected in: mouse lung tissue
• Positive IHC detected in: mouse liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, MCF-7 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15666-1-AP targets SYNJ2BP in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8130

  Product name: Recombinant human ARIP2; SYNJ2BP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-112 aa of BC007704

  Sequence: MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGE

• Full Name: synaptojanin 2 binding protein
• Calculated Molecular Weight: 145 aa, 16 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC007704
• Gene Symbol: SYNJ2BP
• Gene ID (NCBI): 55333
• RRID: AB_2201149
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P57105
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Activin, a member of the TGF-beta superfamily, plays important roles in reproductive tissues as a stimulator of follicle-stimulating hormone (FSH) secretion and inhibits the proliferation of breast cancer cells. Activin receptor-interacting protein 2 (ARIP2), also known as synaptojanin-2-binding protein (SYNJ2BP), is located in the outer membrane of mitochondria. SYNJ2BP is widely distributed in various human tissues, and has been recently identified in mouse tissues as a regulatory protein of activin signal transduction by interacting with activin type II receptors. SYNJ2BP may be a putative growth-promoting factor involved in breast tumorigenesis and tumor development. A double band of size 15.9 kDa can be detected in Western blot (PMID: 23284606).

Publications

What published studies show

SYNJ2BP Polyclonal antibody (Cat# 15666-1-AP) has 16 citations in journals including Science, Nature Metabolism, Neuron, Molecular Cell, Redox Biology, Science Advances, Oncotarget, Cell Reports, and eLife. Research fields span mitochondrial biology (mitophagy, MAM formation, protein insertases), protein quality control/ERAD, neurobiology (neuronal signaling, depression, disc degeneration), oncology (liver and breast cancer), redox biology, and retinal neuroscience.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Science; The endoplasmic reticulum P5A-ATPase is a transmembrane helix dislocase.; Authors - Michael J McKenna
human	WB	Science; MTCH2 is a mitochondrial outer membrane protein insertase; Authors - Alina Guna
mouse	WB,CoIP	Nat Metab; Insulin signalling regulates Pink1 mRNA localization via modulation of AMPK activity to support PINK1 function in neurons; Authors - J Tabitha Hees
	IF	Neuron; Neuronal mitochondria transport Pink1 mRNA via synaptojanin 2 to support local mitophagy.; Authors - Angelika B Harbauer
mouse	WB	Redox Biol; Synaptojanin-2-binding protein ameliorates oxidative stress, neuroinflammation and depression-like behaviors via SYNJ2/PIP(2)/IP(3) signaling pathway.; Authors - Wenjing Wang
human	WB	Mol Cell; ATP13A1 prevents ERAD of folding-competent mislocalized and misoriented proteins; Authors - Michael J McKenna