• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated SYNJ2BP Polyclonal antibody

SYNJ2BP Polyclonal Antibody for IF/ICC
Cat No. CL488-15666

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

ARIP2, FLJ11271, FLJ41973, OMP25, synaptojanin 2 binding protein, SYNJ2BP

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-15666 targets SYNJ2BP in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8130

Product name: Recombinant human ARIP2; SYNJ2BP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-112 aa of BC007704

Sequence: MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNGQDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGE

Predict reactive species
Full Name synaptojanin 2 binding protein
Calculated Molecular Weight 145 aa, 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC007704
Gene Symbol SYNJ2BP
Gene ID (NCBI) 55333
RRIDAB_3672637
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP57105
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Activin, a member of the TGF-beta superfamily, plays important roles in reproductive tissues as a stimulator of follicle-stimulating hormone (FSH) secretion and inhibits the proliferation of breast cancer cells. Activin receptor-interacting protein 2 (ARIP2), also known as synaptojanin-2-binding protein (SYNJ2BP), is located in the outer membrane of mitochondria. ARIP2 is widely distributed in various human tissues, and has been recently identified in mouse tissues as a regulatory protein of activin signal transduction by interacting with activin type II receptors. ARIP2 may be a putative growth-promoting factor involved in breast tumorigenesis and tumor development. A double band of size 15.9 kDa can be detected in Western blot (PMID: 23284606).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 SYNJ2BP antibody CL488-15666Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...