Tested Applications
| Positive WB detected in | HEK-293 cells, HeLa cells, human brain tissue, human liver tissue, NIH/3T3 cells, rat liver tissue, K-562 cells, mouse kidney tissue, A2780 cells, RAW 264.7 cells |
| Positive IP detected in | K-562 cells |
| Positive IHC detected in | human breast cancer tissue, human ovary tumor tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse kidney tissue |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10795-1-AP targets Sestrin 2 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat, pig, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1247 Product name: Recombinant human Sestrin2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 132-480 aa of BC013304 Sequence: HMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT Predict reactive species |
| Full Name | sestrin 2 |
| Calculated Molecular Weight | 54 kDa |
| Observed Molecular Weight | 54-60 kDa |
| GenBank Accession Number | BC013304 |
| Gene Symbol | SESN2/Sestrin 2 |
| Gene ID (NCBI) | 83667 |
| RRID | AB_2185480 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P58004 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SESN is a family of highly conserved, stress-inducible genes that can defend the cell against oxidative damage and oncogenic signaling. SESN2 ,which belongs to the SESN family, has been implicated as a tumor suppressor that can inhibit angiogenesis and promote autophagy, underscoring the importance of elucidating the molecular mechanism by which SESN2 regulates pathways of metabolism and survival.(PMID:22363791). Sesn2 encodes a 480 amino acid protein which can run as a 60 kDa band on SDS-polyacrylamide gel electrophoresis(PMID:20878915).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Sestrin 2 antibody 10795-1-AP | Download protocol |
| IHC protocol for Sestrin 2 antibody 10795-1-AP | Download protocol |
| IP protocol for Sestrin 2 antibody 10795-1-AP | Download protocol |
| WB protocol for Sestrin 2 antibody 10795-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Sestrin 2 Polyclonal antibody (catalog number 10795-1-AP) has 246 citations. These appear in high-impact journals including Nature, Science, Cell, Cell Metabolism, Nature Communications, Molecular Cell, Cell Reports, Free Radical Biology and Medicine, Antioxidants & Redox Signaling, and the Journal of Biological Chemistry. Research fields span mTORC1 signaling and nutrient/amino acid sensing, oxidative stress and Nrf2/Keap1 pathways, autophagy and mitophagy, ferroptosis, endoplasmic reticulum stress, cardioprotection, liver injury, neuroprotection, and cancer biology.
| Species | Application | Title |
|---|---|---|
Cancer Cell Macropinocytosis maintains CAF subtype identity under metabolic stress in pancreatic cancer | ||
Reviews
What customers say
Both reviewers report strong performance. One user (4/5) used the antibody at 1:3000 for Western Blot, IHC, and IP on HeK293T and HeLa cells, noting it works very well for both WB and IHC. The other (5/5) used it at 1:1000 for WB on HEK293T, highlighting its sensitivity and the consistently specific, thick band it produces. Overall, users find this antibody reliable, sensitive, and versatile across multiple applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ashish (Verified Customer) (01-04-2022) | This is very good antibody for western blotting , even works good for IHC
|
H (Verified Customer) (04-05-2020) | This antibody works very well and very sensitive. I always get a specific and thick band.
 |
