• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated Sestrin 2 Polyclonal antibody

Sestrin 2 Polyclonal Antibody for IF/ICC
Cat No. CL594-10795

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

DKFZp761M0212, DKFZp761M02121, HI95, SES2, SESN2, SEST2, sestrin 2, Sestrin2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-10795 targets Sestrin 2 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1247

Product name: Recombinant human Sestrin2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 132-480 aa of BC013304

Sequence: HMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT

Predict reactive species
Full Name sestrin 2
Calculated Molecular Weight 54 kDa
Observed Molecular Weight 54-60 kDa
GenBank Accession NumberBC013304
Gene Symbol SESN2/Sestrin 2
Gene ID (NCBI) 83667
RRIDAB_2919745
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP58004
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

SESN is a family of highly conserved, stress-inducible genes that can defend the cell against oxidative damage and oncogenic signaling. SESN2 ,which belongs to the SESN family, has been implicated as a tumor suppressor that can inhibit angiogenesis and promote autophagy, underscoring the importance of elucidating the molecular mechanism by which SESN2 regulates pathways of metabolism and survival.(PMID:22363791). Sesn2 encodes a 480 amino acid protein which can run as a 60 kDa band on SDS-polyacrylamide gel electrophoresis(PMID:20878915).

Protocols

Product Specific Protocols
IF protocol for CL594 Sestrin 2 antibody CL594-10795Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...