Recombinant human Sestrin2 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag20638
Synonyms
SESN2, sestrin 2, Sestrin2, EC:1.11.1.-, Hi95
Validation Data Gallery View All
Product Information
| Peptide Sequence |
HMAEFLQTGGDPEWLLGLHRAPEKLRKLSEINKLLAHRPWLITKEHIQALLKTGEHTWSLAELIQALVLLTHCHSLSSFVFGCGILPEGDADGSPAPQAPTPPSEQSSPPSRDPLNNSGGFESARDVEALMERMQQLQESLLRDEGTSQEEMESRFELEKSESLLVTPSADILEPSPHPDMLCFVEDPTFGYEDFTRRGAQAPPTFRAQDYTWEDHGYSLIQRLYPEGGQLLDEKFQAAYSLTYNTIAMHSGVDTSVLRRAIWNYIHCVFGIRYDDYDYGEVNQLLERNLKVYIKTVACYPEKTTRRMYNLFWRHFRHSEKVHVNLLLLEARMQAALLYALRAITRYMT
(132-480 aa encoded by BC013304) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
