Syndetin/CCDC132 Polyclonal antibody

• 

  WB analysis using 27749-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27749-1-AP (Syndetin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 27749-1-AP

  IP result of anti-Syndetin/CCDC132 (IP:27749-1-AP, 4ug; Detection:27749-1-AP 1:300) with mouse brain tissue lysate 4000 ug.

Syndetin/CCDC132 Polyclonal Antibody for WB, IP, ELISA

Cat No. 27749-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

CCDC132, EARP/GARPII complex subunit VPS50, Syndetin, Syndetin/CCDC132, VPS50

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27749-1-AP targets Syndetin/CCDC132 in WB, IP, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26944

  Product name: Recombinant human CCDC132 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 337-593 aa of BC152424

  Sequence: EWHEKHDNEDTASASEGSNMIGTEETNFDRGYIKKKLEHGLTRIWQDVQLKVKTYLLGTDLSIFKYDDFIFVLDIISRLMQVGEEFCGSKSEVLQESIRKQSVNYFKNYHRTRLDELRMFLENETWELCPVKSNFSILQLHEFKFMEQSRSPSVSPSKQPVSTSSKTVTLFEQYCSGGNPFEIQANHKDEETEDVLASNGYESDEQEKSAYQEYDSDSDVPEELKRDYVDEQTGDGPVKSVSRETLKSRKKSDYSLN

• Full Name: coiled-coil domain containing 132
• Calculated Molecular Weight: 964 aa, 111 kDa
• Observed Molecular Weight: 110-120 kDa
• GenBank Accession Number: BC152424
• Gene Symbol: Syndetin/CCDC132
• Gene ID (NCBI): 55610
• RRID: AB_2880961
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96JG6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.