Recombinant human TBK1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag24657
Synonyms
TBK1, EC:2.7.11.1, NF kappa B activating kinase, NF-kappa-B-activating kinase, Serine/threonine protein kinase TBK1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
LYYHATKAMTHFTDECVKKYEAFLNKSEEWIRKMLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMDGGLRNVDCL
(590-729 aa encoded by BC034950) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
