Recombinant human TBRG1 protein
Source
e coli.-derived, PET28a
Tag
6*His
Format
Liquid
Cat no : Ag4346
Synonyms
TBRG1, NIAM
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MSLLDGLASSPRAPLQSSKARMKKLPKKSQNEKYRLKYLRLRKAAKATVFVSLTHVQPVPSWRLPHKIFPQAVPPSQCDSINTVLAFPYTLLLVSLVSLDKLRNFSVSSSVNELVTVLQNNEY
(1-123 aa encoded by BC032312) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
