TCTN2 Recombinant monoclonal antibody, PBS Only

TCTN2 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 82121-1-PBS
Clone No.1E17

Host / Isotype

Rabbit / IgG

Reactivity

Human, rat

Applications

WB, Indirect ELISA

C12orf38, FLJ12975, TCTN2, TECT2, Tectonic 2, tectonic family member 2

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82121-1-PBS targets TCTN2 in WB, Indirect ELISA applications and shows reactivity with Human, rat samples.

Tested Reactivity Human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10725

Product name: Recombinant human TCTN2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 351-697 aa of BC009112

Sequence: VIYEEATDLDKFITNTETPLNNGSTPRIVNVEEHYIFKWNNNTISEINVKIFRAEINAHQKGIMTQRFVVKFLSYNSGNEEELSGNPGYQLGKPVRALNINRMNNVTTLHLWQSAGRGLCTSATFKPILFGENVLSGCLLEVGINENCTQLRENAVERLDSLIQATHVAMRGNSDYADLSDGWLEIIRVDAPDPGADPLASSVNGMCLDIPAHLSIRILISDAGAVEGITQQEILGVETRFSSVNWQYQCGLTCEHKADLLPISASVQFIKIPAQLPHPLTRFQINYTEYDCNRNEVCWPQLLYPWTQYYQGELHSQCVAKGLLLLLFLTLALFLSNPWTRICKAYS

Predict reactive species
Full Name tectonic family member 2
Calculated Molecular Weight 697 aa, 77 kDa
Observed Molecular Weight90 kDa
GenBank Accession NumberBC009112
Gene Symbol TCTN2
Gene ID (NCBI) 79867
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96GX1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TCTN2 (tectonic-2 or TECT2) is a type I membrane protein that belongs to the tectonic family, which consists of TCTN1, TCTN2 and TCTN3. Studies in mice suggest that tectonic may be involved in Hedgehog (Hh) signaling, and essential for ciliogenesis. Tectonic is component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. It exists two spilcing isoforms. The first aberrant transcript introduces 104 base pair from intron 13 and would delete 196 original amino acid, introduce two novel amino acids, and prematurely truncate the 697aa protein at residue number 504. The second transcript lacks exon 14 and would delete 195 original amino acids, introduce four novel amino acids, and prematurely truncate the 697 aa protein at residue number 507. The molecular weight of two isoforms are about 50kDa. We detected the 50kDa and 90kDa protein by immunoprecipitaion, but 50kDa protein may be the splicing isoform or non-specific band.

Loading...
||
New chat Able
正在加载,请稍候...