TCTN2 Recombinant monoclonal antibody

TCTN2 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 82121-1-RR
Clone No.1E17

Host / Isotype

Rabbit / IgG

Reactivity

Human, rat

Applications

WB, ELISA

C12orf38, FLJ12975, TCTN2, TECT2, Tectonic 2, tectonic family member 2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, A431 cells, HeLa cells, Jurkat cells, K-562 cells, RAW 264.7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82121-1-RR targets TCTN2 in WB, ELISA applications and shows reactivity with Human, rat samples.

Tested Reactivity Human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10725

Product name: Recombinant human TCTN2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 351-697 aa of BC009112

Sequence: VIYEEATDLDKFITNTETPLNNGSTPRIVNVEEHYIFKWNNNTISEINVKIFRAEINAHQKGIMTQRFVVKFLSYNSGNEEELSGNPGYQLGKPVRALNINRMNNVTTLHLWQSAGRGLCTSATFKPILFGENVLSGCLLEVGINENCTQLRENAVERLDSLIQATHVAMRGNSDYADLSDGWLEIIRVDAPDPGADPLASSVNGMCLDIPAHLSIRILISDAGAVEGITQQEILGVETRFSSVNWQYQCGLTCEHKADLLPISASVQFIKIPAQLPHPLTRFQINYTEYDCNRNEVCWPQLLYPWTQYYQGELHSQCVAKGLLLLLFLTLALFLSNPWTRICKAYS

Predict reactive species
Full Name tectonic family member 2
Calculated Molecular Weight 697 aa, 77 kDa
Observed Molecular Weight90 kDa
GenBank Accession NumberBC009112
Gene Symbol TCTN2
Gene ID (NCBI) 79867
RRIDAB_3086465
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96GX1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TCTN2 (tectonic-2 or TECT2) is a type I membrane protein that belongs to the tectonic family, which consists of TCTN1, TCTN2 and TCTN3. Studies in mice suggest that tectonic may be involved in Hedgehog (Hh) signaling, and essential for ciliogenesis. Tectonic is component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes. It exists two spilcing isoforms. The first aberrant transcript introduces 104 base pair from intron 13 and would delete 196 original amino acid, introduce two novel amino acids, and prematurely truncate the 697aa protein at residue number 504. The second transcript lacks exon 14 and would delete 195 original amino acids, introduce four novel amino acids, and prematurely truncate the 697 aa protein at residue number 507. The molecular weight of two isoforms are about 50kDa. We detected the 50kDa and 90kDa protein by immunoprecipitaion, but 50kDa protein may be the splicing isoform or non-specific band.

Protocols

Product Specific Protocols
WB protocol for TCTN2 antibody 82121-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...