• Featured Product
  • KD/KO Validated

TDP-43 (N-terminal) Recombinant monoclonal antibody

TDP-43 (N-terminal) Uni-rAb® Recombinant Antibody for WB, IHC, IHC-Autostainer, IF/ICC, IF-P, FC (Intra), IP, ELISA, ChIP-qPCR

Cat No. 80002-1-RR
Clone No.16A22

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IHC-Autostainer, IF/ICC, IF-P, FC (Intra), IP, ELISA, ChIP-qPCR

TDP-43 (for IF/FC), TARDBP, TDP 43, TDP43, TDP-43

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HAP1 cells, K-562 cells, Neuro-2a cells, C6 cells
Positive IP detected inHAP1 cells, HeLa cells
Positive IHC-Autostainer detected inhuman brain tissue
Positive IHC detected inmouse brain tissue, human brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat brain tissue
Positive IF/ICC detected inHeLa cells, HepG2 cells, SH-SY5Y cells, HAP1 cells
Positive FC (Intra) detected inHeLa cells
Positive ChIP-qPCR detected inHEK-293T cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)-AUTOSTAINERIHC-AUTOSTAINER : 1:50-1:500
Immunohistochemistry (IHC)IHC : 1:1600-1:6400
Immunofluorescence (IF)-PIF-P : 1:800-1:3200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
CHIP-QPCRCHIP-QPCR : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

80002-1-RR targets TDP-43 (N-terminal) in WB, IHC, IHC-Autostainer, IF/ICC, IF-P, FC (Intra), IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1231

Product name: Recombinant human TDP-43 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-260 aa of BC001487

Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA

Predict reactive species
Full Name TAR DNA binding protein
Calculated Molecular Weight 43 kDa
Observed Molecular Weight 43 kDa
GenBank Accession NumberBC001487
Gene Symbol TDP-43
Gene ID (NCBI) 23435
RRIDAB_2882934
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13148
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The TARDBP gene encodes the TDP-43 protein, initially found to repress HIV-1 transcription by binding TAR DNA. TDP-43 has since been shown to bind RNA as well as DNA, and have multiple functions in transcriptional repression, translational regulation and pre-mRNA splicing. For instance, it is reported to regulate alternate splicing of the CTFR gene. In 2006 Neumann et al. found that hyperphosphorylated, ubiquitinated and/or cleaved forms of TDP-43, collectively known as pathological TDP-43, play a major role in the disease mechanisms of ubiquitin-positive, tau- and alpha-synuclein-negative frontotemporal dementia (FTLD-U) and in amyotrophic lateral sclerosis (ALS). Proteintech's 80002-1-RR is a rabbit recombinant TDP-43 antibody recognizing N-terminal TDP-43. It recognizes the intact 43 kDa protein as well as all posttranslationally modified and truncated forms in multiple applications. Various forms of TDP-43 exist, including 18-35 kDa of cleaved C-terminal fragments, 45-50 kDa phospho-protein, 55 kDa glycosylated form, 75 kDa hyperphosphorylated form, and 90-300 kDa cross-linked form. (PMID: 17023659, 19823856, 21666678, 22193176) Recently TDP-43 has been reported to be overexpressed in triple negative breast cancer (TNBC) and it may be a potential target for TNBC diagnosis and drug design. (PMID: 29581274)

80002-1-RR antibody works well in IF experiment.

Protocols

Product Specific Protocols
FC protocol for TDP-43 (N-terminal) antibody 80002-1-RRDownload protocol
IF protocol for TDP-43 (N-terminal) antibody 80002-1-RRDownload protocol
IHC protocol for TDP-43 (N-terminal) antibody 80002-1-RRDownload protocol
IP protocol for TDP-43 (N-terminal) antibody 80002-1-RRDownload protocol
WB protocol for TDP-43 (N-terminal) antibody 80002-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

bioRxiv

Patient-derived Induced Pluripotent Stem Cells as a Model to Study Frontotemporal Dementia Pathologies

Authors - Sonia Infante-Tadeo
humanWB,IP,IF

F1000Res

The identification of high-performing antibodies for TDP-43 for use in Western Blot, immunoprecipitation and immunofluorescence

Authors - Donovan Worrall
humanIHC

J Neuropathol Exp Neurol

COVID-19 could worsen cerebral amyloid angiopathy

Authors - Julie Dewisme
humanIF

Nat Chem Biol

Small-molecule dissolution of stress granules by redox modulation benefits ALS models

Authors - Hiroyuki Uechi
mouseWB,IF

Neural Regen Res

5-Hydroxytryptamine: a potential therapeutic target in amyotrophic lateral sclerosis

Authors - Shi-Shi Jiang
Loading...
||
New chat

Able

正在加载,请稍候...