Tested Applications
| Positive WB detected in | HeLa cells, HAP1 cells, K-562 cells, Neuro-2a cells, C6 cells |
| Positive IP detected in | HAP1 cells, HeLa cells |
| Positive IHC-Autostainer detected in | human brain tissue |
| Positive IHC detected in | mouse brain tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat brain tissue |
| Positive IF/ICC detected in | HeLa cells, HepG2 cells, SH-SY5Y cells, HAP1 cells |
| Positive FC (Intra) detected in | HeLa cells |
| Positive ChIP-qPCR detected in | HEK-293T cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:20000-1:100000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC)-AUTOSTAINER | IHC-AUTOSTAINER : 1:50-1:500 |
| Immunohistochemistry (IHC) | IHC : 1:1600-1:6400 |
| Immunofluorescence (IF)-P | IF-P : 1:800-1:3200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| CHIP-QPCR | CHIP-QPCR : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 1 publications below |
| IF | See 3 publications below |
| IP | See 1 publications below |
Product Information
80002-1-RR targets TDP-43 (N-terminal) in WB, IHC, IHC-Autostainer, IF/ICC, IF-P, FC (Intra), IP, ELISA, ChIP-qPCR applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag1231 Product name: Recombinant human TDP-43 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-260 aa of BC001487 Sequence: MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGNLVYVVNYPKDNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSKQSQDEPLRSRKVFVGRCTEDMTEDELREFFSQYGDVMDVFIPKPFRAFAFVTFADDQIAQSLCGEDLIIKGISVHISNA Predict reactive species |
| Full Name | TAR DNA binding protein |
| Calculated Molecular Weight | 43 kDa |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | BC001487 |
| Gene Symbol | TDP-43 |
| Gene ID (NCBI) | 23435 |
| RRID | AB_2882934 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13148 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The TARDBP gene encodes the TDP-43 protein, initially found to repress HIV-1 transcription by binding TAR DNA. TDP-43 has since been shown to bind RNA as well as DNA, and have multiple functions in transcriptional repression, translational regulation and pre-mRNA splicing. For instance, it is reported to regulate alternate splicing of the CTFR gene.
In 2006 Neumann et al. found that hyperphosphorylated, ubiquitinated and/or cleaved forms of TDP-43, collectively known as pathological TDP-43, play a major role in the disease mechanisms of ubiquitin-positive, tau- and alpha-synuclein-negative frontotemporal dementia (FTLD-U) and in amyotrophic lateral sclerosis (ALS).
Proteintech's 80002-1-RR is a rabbit recombinant TDP-43 antibody recognizing N-terminal TDP-43. It recognizes the intact 43 kDa protein as well as all posttranslationally modified and truncated forms in multiple applications. Various forms of TDP-43 exist, including 18-35 kDa of cleaved C-terminal fragments, 45-50 kDa phospho-protein, 55 kDa glycosylated form, 75 kDa hyperphosphorylated form, and 90-300 kDa cross-linked form. (PMID: 17023659, 19823856, 21666678, 22193176)
Recently TDP-43 has been reported to be overexpressed in triple negative breast cancer (TNBC) and it may be a potential target for TNBC diagnosis and drug design. (PMID: 29581274)
80002-1-RR antibody works well in IF experiment.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for TDP-43 (N-terminal) antibody 80002-1-RR | Download protocol |
| IF protocol for TDP-43 (N-terminal) antibody 80002-1-RR | Download protocol |
| IHC protocol for TDP-43 (N-terminal) antibody 80002-1-RR | Download protocol |
| IP protocol for TDP-43 (N-terminal) antibody 80002-1-RR | Download protocol |
| WB protocol for TDP-43 (N-terminal) antibody 80002-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
bioRxiv Patient-derived Induced Pluripotent Stem Cells as a Model to Study Frontotemporal Dementia Pathologies | ||
F1000Res The identification of high-performing antibodies for TDP-43 for use in Western Blot, immunoprecipitation and immunofluorescence | ||
Nat Chem Biol Small-molecule dissolution of stress granules by redox modulation benefits ALS models | ||
Neural Regen Res 5-Hydroxytryptamine: a potential therapeutic target in amyotrophic lateral sclerosis |



































