Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TEAD4 Polyclonal antibody

TEAD4 Polyclonal Antibody for WB, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IP, CoIP, ChIP, ELISA

EFTR 2, hRTEF 1B, RTEF1, TCF13L1, TEA domain family member 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for TEAD4 in ?

Tested Applications

Positive WB detected inBGC-823 cells, HepG2 cells, MCF-7 cells, MDA-MB-231 cells, L02 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12418-1-AP targets TEAD4 in WB, IF, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3059

Product name: Recombinant human TEAD4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 135-434 aa of BC015497

Sequence: SAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Predict reactive species
Full Name TEA domain family member 4
Calculated Molecular Weight 434 aa, 48 kDa
Observed Molecular Weight48 kDa
GenBank Accession NumberBC015497
Gene Symbol TEAD4
Gene ID (NCBI) 7004
RRIDAB_2203074
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ15561
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TEAD4 belongs to a protein family that share the TEA/ATTS domain. The transcriptional activity of TEAD4 required several regions of the proteins , a TBP-associated factor and a limiting transcriptional intermediary facotrs. TEAD4 also preforms an essential role in the Hippo signaling pathway. TEAD4 regulates gene expression of YAP1 and WWTR1/TAZ, thus mediating cell proliferation, migration and epithelial mesenchymal transition induction. The calculated molecular weight of TEAD4 is 48 kDa, but molecular weight of TEAD4 is detected about 50-55 kDa.

Protocols

Product Specific Protocols
WB protocol for TEAD4 antibody 12418-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-TEAD4 antibody (Cat# 12418-1-AP) has 47 citations spanning high-impact journals including Nature Metabolism, Nature Communications, ACS Nano, Advanced Science, Cell Reports, Journal of Biological Chemistry, and Journal of Experimental & Clinical Cancer Research. Research fields cover oncology (breast, colorectal, gastric, lung, liver, bladder, cervical, esophageal cancers), fibrosis, bone biology, pulmonary hypertension, ferroptosis, stem cell biology, and inflammatory diseases.

SpeciesApplicationTitle
mouseChIP

Nat Metab

Early-activated extracellular matrix proteins shape the metabolic and spatial dynamics of the kidney fibrotic microenvironment.

Authors - Yuan Gui
mouseWB

Nat Commun

Escherichia coli promotes colorectal cancer metastasis by maintaining enhancer-promoter loops through releasing neutrophil extracellular traps.

Authors - Banglun Pan
mouseWB

Nat Commun

Long noncoding RNA Malat1 protects against osteoporosis and bone metastasis

Authors - Yang Zhao
ratWB

ACS Nano

Nano-Self-Assembled Particles Loaded with Aldehyde Dehydrogenase 2 Agonist Inhibit Ischemia-Reperfusion Injury of Transplanted Kidneys.

Authors - Qianchao Hu
humanWB

J Exp Clin Cancer Res

TEAD4 functions as a prognostic biomarker and triggers EMT via PI3K/AKT pathway in bladder cancer.

Authors - Ming Chi
  • KD Validated
rat,mouse,humanWB

Adv Sci (Weinh)

TEAD1 Enhances Exosome Secretion and Promotes Exosome-Mediated Tissue Regeneration.

Authors - Yan Pu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for this antibody is from a researcher who used it for Western Blot at a 1:2500 dilution on PC3 cell lines. They tested it across three conditions: vector control, PDEF overexpression, and PDEF TWIST overexpression. The reviewer gave the product a perfect 5-star rating, indicating strong performance and satisfaction with the antibody's results in their experimental setup.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Pramod Bahadur (Verified Customer) (03-05-2024)

We used this antibody for PC3 cell lines with vector control, PDEF over expression and PDEF TWIST overexpression

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2500
  • Cell Tissue Type: PC3
TEAD4 Antibody Western Blot validation (1:2500 dilution) in PC3 (Cat no:12418-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...