TEC Polyclonal antibody

• 

  WB analysis using 18085-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18085-1-AP (TEC antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 18085-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 18085-1-AP (TEC antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 18085-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 18085-1-AP (TEC antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 18085-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 18085-1-AP (TEC antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TEC Polyclonal Antibody for WB, IHC, ELISA

Cat No. 18085-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

PSCTK4, TEC, tec protein tyrosine kinase, Tyrosine protein kinase Tec

---

Tested Applications

• Positive WB detected in: K-562 cells, mouse kidney tissue, Jurkat cells, rat kidney tissue
• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18085-1-AP targets TEC in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12804

  Product name: Recombinant human TEC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 282-631 aa of BC101711

  Sequence: TVSLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLRCWQEKPEGRPSFEDLLRTIDELVECEETFGR

• Full Name: tec protein tyrosine kinase
• Calculated Molecular Weight: 631 aa, 74 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC101711
• Gene Symbol: TEC
• Gene ID (NCBI): 7006
• RRID: AB_2878494
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P42680
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.