TFG Polyclonal antibody

• 

  WB analysis using 11571-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 11571-1-AP (TFG antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human gliomas using 11571-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11571-1-AP (TFG antibody) at dilution of 1:100 (under 10x lens).

• 

  IF Staining of A549 using 11571-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed A549 cells using 11571-1-AP (TFG antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

TFG Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11571-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

TRKT3, TRK-fused gene protein, TRK fused gene protein, TRK fused gene, TF6

---

Tested Applications

• Positive WB detected in: A549 cells, PC-3 cells
• Positive IHC detected in: human gliomas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A549 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 4 publications below
• IF: See 3 publications below

Product Information

11571-1-AP targets TFG in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2151

  Product name: Recombinant human TFG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-400 aa of BC023599

  Sequence: MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQTGPQQPQQFQGYGQQPTSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMAPSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR

• Full Name: TRK-fused gene
• Calculated Molecular Weight: 400 aa, 43 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC023599
• Gene Symbol: TFG
• Gene ID (NCBI): 10342
• RRID: AB_2203102
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92734
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein TFG (TRK-fused gene protein) plays a role in regulating phosphotyrosine-specific phosphatase-1 activity. Mutations in TFG may have important clinical relevance for current therapeutic strategies to treat metastatic melanoma. Defects in TFG are a cause of thyroid papillary carcinoma (TPC), a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Hereditary motor and sensory neuropathy with proximal dominant involvement (HMSN-P) is an autosomal-dominant neurodegenerative disorder characterized by widespread fasciculations, proximal-predominant muscle weakness, and atrophy followed by distal sensory involvement. Recent genetic investigation indicates that formation of TFG-containing cytoplasmic inclusions and concomitant mislocalization of TAR DNA-binding protein 43 kDa (TDP-43) underlie motor neuron degeneration in HMSN-P. Pathological overlap of proteinopathies involving TFG and TDP-43 highlights a new pathway leading to motor neuron degeneration.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Cell Res; A new type of ERGIC-ERES membrane contact mediated by TMED9 and SEC12 is required for autophagosome biogenesis.; Authors - Shulin Li ; KD Validated
human,mouse	WB	Redox Biol; Selenoprotein K contributes to CD36 subcellular trafficking in hepatocytes by accelerating nascent COPII vesicle formation and aggravates hepatic steatosis; Authors - Mengyue You
mouse	WB	Neurobiol Dis; Evidence of TRK-Fused Gene (TFG1) function in the ubiquitin-proteasome system.; Authors - Takuya Yagi ; KD Validated
human	IF	J Med Genet; Novel TFG mutation causes autosomal-dominant spastic paraplegia and defects in autophagy; Authors - Ling Xu
human	IF	Muscle Nerve; Muscle pathology of hereditary motor and sensory neuropathy with proximal dominant involvement with TFG mutation.; Authors - Satoshi Yamashita
	WB	Commun Biol; A pore-forming protein drives macropinocytosis to facilitate toad water maintaining.; Authors - Zhong Zhao