TRIF/TICAM1 Polyclonal antibody

• 

  WB analysis using 23288-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 23288-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Ramos using 23288-1-AP

  Ramos cells were subjected to SDS PAGE followed by western blot with 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 23288-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human brain using 23288-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of human liver using 23288-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 23288-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human testis using 23288-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human testis using 23288-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 23288-1-AP (TRIF/TICAM1 antibody) at dilution of 1:200 (under 40x lens).

TRIF/TICAM1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23288-1-AP

Publications(25)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF, ELISA

Synonyms

TICAM1, TRIF, MyD88-3, Proline-rich, vinculin and TIR domain-containing protein B, PRVTIRB

---

Tested Applications

• Positive WB detected in: MOLT-4 cells, Ramos cells, Raji cells
• Positive IHC detected in: human brain tissue, human testis tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 23 publications below
• IHC: See 2 publications below
• IF: See 2 publications below

Product Information

23288-1-AP targets TRIF/TICAM1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19779

  Product name: Recombinant human TICAM1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-200 aa of BC035331

  Sequence: LDEHSQIFARKVANTFKPHRLQARKAMWRKEQDTRALREQSQHLDGERMQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTGAPYGARMPFGGQVPLGAPPPFPTWPGCPQPPPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRGSQAPEDKTQEAE

• Full Name: toll-like receptor adaptor molecule 1
• Calculated Molecular Weight: 712 aa, 76 kDa
• Observed Molecular Weight: 66-76 kDa
• GenBank Accession Number: BC035331
• Gene Symbol: TRIF
• Gene ID (NCBI): 148022
• RRID: AB_2879247
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IUC6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Adv Mater; Manganese@Albumin Nanocomplex and Its Assembled Nanowire Activate TLR4-Dependent Signaling Cascades of Macrophages; Authors - Shuodan Huang
mouse	WB	Immunity; The gut microbiota prime systemic antiviral immunity via the cGAS-STING-IFN-I axis.; Authors - Saskia F Erttmann
human	WB	J Med Virol; SARS-CoV-2 NSP8 suppresses type I and III IFN responses by modulating the RIG-I/MDA5, TRIF, and STING signaling pathways; Authors - Jian Deng
pig	WB	Nucleic Acids Res; The N6-methyladenosine RNA-binding protein YTHDF1 modulates the translation of TRAF6 to mediate the intestinal immune response.; Authors - Xin Zong
human	WB	Biochim Biophys Acta Mol Basis Dis; Gut-derived 4-hydroxyphenylacetic acid attenuates sepsis-induced acute kidney injury by upregulating ARC to inhibit necroptosis; Authors - Sheng An
human	WB	Int J Mol Sci; PCSK9 Enhances Cardiac Fibrogenesis via the Activation of Toll-like Receptor and NLRP3 Inflammasome Signaling; Authors - Cheng-Chih Chung