Tested Applications
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| IHC | See 8 publications below |
| IF | See 1 publications below |
Product Information
10753-1-AP targets TIMP1 in IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1146 Product name: Recombinant human TIMP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-169 aa of BC007097 Sequence: MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCL Predict reactive species |
| Full Name | TIMP metallopeptidase inhibitor 1 |
| Calculated Molecular Weight | 23 kDa |
| GenBank Accession Number | BC007097 |
| Gene Symbol | TIMP1 |
| Gene ID (NCBI) | 7076 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P01033 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Tissue Inhibitor of Metalloproteinases-1 (TIMP1) is a naturally occurring protein in the human organism regulating the activity of matrix metalloproteinases (MMPs). TIMP1 encodes a 931 base-pair mRNA and a 207 amino acid protein. Overexpression of TIMP1 can lead to a substantially increase of genes involved in proliferation, apoptosis and signal transduction. In addition, TIMP1 was found to decrease tumor cell sensitivity to multiple anticancer drugs by activation of downstream pathways and exhibited anti-apoptotic activity. Specifically, the TIMP1 could degrade cyclinB1 and activate the NF-kβ signaling pathway to protect breast cancer cells against chemotherapy-induced cell death.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TIMP1 antibody 10753-1-AP | Download protocol |
| IF protocol for TIMP1 antibody 10753-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Biol Macromol Anti-metastatic effects of antrodan, the Antrodia cinnamomea mycelia glycoprotein, in lung carcinoma cells. | ||
Br J Pharmacol Dual Inhibition of Cannabinoid-1 Receptor and iNOS Attenuates Obesity-induced Chronic Kidney Disease. | ||
Cancer Cytopathol A panel of protein markers for the early detection of lung cancer with bronchial brushing specimens. | ||
Sci Rep Quercetin prevents hepatic fibrosis by inhibiting hepatic stellate cell activation and reducing autophagy via the TGF-β1/Smads and PI3K/Akt pathways. | ||
Mar Drugs 11-epi-Sinulariolide Acetate Reduces Cell Migration and Invasion of Human Hepatocellular Carcinoma by Reducing the Activation of ERK1/2, p38MAPK and FAK/PI3K/AKT/mTOR Signaling Pathways. |







