• Featured Product
  • KD/KO Validated

TIMP1 Polyclonal antibody

TIMP1 Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 16644-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

TIMP-1, CLGI, Collagenase inhibitor, EPA, Erythroid-potentiating activity

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHL-60 cells, HT-29 cells, HeLa cells, SKOV-3 cells
Positive IF/ICC detected inHT-29 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16644-1-AP targets TIMP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, rabbit, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10006

Product name: Recombinant human TIMP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-207 aa of BC000866

Sequence: MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA

Predict reactive species
Full Name TIMP metallopeptidase inhibitor 1
Calculated Molecular Weight 23 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC000866
Gene Symbol TIMP1
Gene ID (NCBI) 7076
RRIDAB_2878292
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01033
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TIMP1 is a member of the family of matrix metalloproteinase inhibitors, which contains four members (TIMP1, TIMP2, TIMP3, and TIMP4). Tissue inhibitors of metalloproteinases (TIMPs) are multifaceted molecules that exhibit properties beyond their classical proteinase inhibitory function. TIMP1 has several MMP-independent functions such as modulation of angiogenesis, promotion of cell proliferation, and inhibition of apoptosis. TIMP1 plays important role in cell cycle regulation and cancer progression. Recently, clinical studies have shown that the aberrant expression of TIMP1 is associated with an unfavorable prognosis in a series of tumors, such as gastric cancer, papillary thyroid carcinoma, cutaneous melanoma and breast cancer. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium.

Protocols

Product Specific Protocols
IF protocol for TIMP1 antibody 16644-1-APDownload protocol
WB protocol for TIMP1 antibody 16644-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
WB

Acta Pharm Sin B

TIMP1 preserves the blood-brain barrier through interacting with CD63/integrin β 1 complex and regulating downstream FAK/RhoA signaling.

Authors - Jingshu Tang
humanWB

Proc Natl Acad Sci U S A

Addiction to Golgi-resident PI4P synthesis in chromosome 1q21.3-amplified lung adenocarcinoma cells.

Authors - Lei Shi
humanWB,IF

J Neuroinflammation

Identification of TIMP1 as an inflammatory biomarker associated with temporal lobe epilepsy based on integrated bioinformatics and experimental analyses

Authors - Ya He
humanWB

Cell Death Dis

α1,3-fucosylation of MEST promotes invasion potential of cytotrophoblast cells by activating translation initiation

Authors - Hao Wang
humanWB

Biomed Pharmacother

TrxR/Trx inhibitor butaselen ameliorates pulmonary fibrosis by suppressing NF-κB/TGF-β1/Smads signaling

Authors - Yifan Chen
humanIF

Cell Mol Gastroenterol Hepatol

Sestrin Proteins Protect Against Lipotoxicity-Induced Oxidative Stress in the Liver via Suppression of C-Jun N-Terminal Kinases.

Authors - Zhigang Fang
Loading...
||
New chat Able
正在加载,请稍候...