TMC2 Polyclonal antibody

TMC2 Polyclonal Antibody for IHC, ELISA
Cat No. 27618-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

IHC, ELISA

C20orf145, TMC2, transmembrane channel like 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse brain tissue, mouse cerebellum tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27618-1-AP targets TMC2 in IHC, ELISA applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26366

Product name: Recombinant human TMC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 805-906 aa of NM_080751

Sequence: MSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPSASQSQAMDKKAQGPGTSNSASRTTLPASGHLPISRPPGIGPDSGHAPSQTHPWRSASGKSAQRPPH

Predict reactive species
Full Name transmembrane channel-like 2
Calculated Molecular Weight 103 kDa
GenBank Accession NumberNM_080751
Gene Symbol TMC2
Gene ID (NCBI) 117532
RRIDAB_3085977
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8TDI7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for TMC2 antibody 27618-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...