TMEM115 Polyclonal antibody

• 

  WB analysis of U2OS using 25536-1-AP

  U2OS cells were subjected to SDS PAGE followed by western blot with 25536-1-AP (TMEM115 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 25536-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25536-1-AP (TMEM115 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 25536-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 25536-1-AP (TMEM115 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary cancer using 25536-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 25536-1-AP (TMEM115 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 25536-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 25536-1-AP (TMEM115 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human intrahepatic cholangiocarcinoma using 25536-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 25536-1-AP (TMEM115 antibody) at dilution of 1:100 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

TMEM115 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25536-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

Transmembrane protein 115, Placental protein 6, PL6, LUCA11.2

---

Tested Applications

• Positive WB detected in: U2OS cells, mouse skeletal muscle tissue, rat skeletal muscle tissue
• Positive IHC detected in: human ovary cancer tissue, human intrahepatic cholangiocarcinoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25536-1-AP targets TMEM115 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22258

  Product name: Recombinant human TMEM115 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 233-351 aa of BC017367

  Sequence: QPVVGLLANLVHSLLVKVKICQKTVKRYDVGAPSSITISLPGTDPQDAERRRQLALKALNERLKRVEDQSIWPSMDDDEEESGAKVDSPLPSDKAPTPPGKGAAPESSLITFEAAPPTL

• Full Name: transmembrane protein 115
• Calculated Molecular Weight: 351 aa, 38 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC017367
• Gene Symbol: TMEM115
• Gene ID (NCBI): 11070
• RRID: AB_3669482
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12893
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM115 also known as PL6, located on chromosome 3p21.3, was originally thought to function as a tumor suppressor. TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport.