TMEM194A Polyclonal antibody

• 

  WB analysis of MCF-7 using 24477-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 24477-1-AP (TMEM194A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse liver using 24477-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 24477-1-AP (TMEM194A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

TMEM194A Polyclonal Antibody for WB, ELISA

Cat No. 24477-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

KIAA0286, TMEM194, TMEM194A, transmembrane protein 194A

---

Tested Applications

• Positive WB detected in: MCF-7 cells, mouse liver tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24477-1-AP targets TMEM194A in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21614

  Product name: Recombinant human TMEM194A protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 224-371 aa of BC126300

  Sequence: QIPHIALAIIIIALCTKNLEHPIQWLYITCRKVCKGAEKPVPPRLLTEEEYRIQGEVETRKALEELREFCNSPDCSAWKTVSRIQSPKRFADFVEGSSHLTPNEVSVHEQEYGLGSIIAQDEIYEEASSEEEDSYSRCPAITQNNFLT

• Full Name: transmembrane protein 194A
• Calculated Molecular Weight: 444 aa, 51 kDa
• Observed Molecular Weight: 40-42 kDa, 50-55 kDa
• GenBank Accession Number: BC126300
• Gene Symbol: TMEM194A
• Gene ID (NCBI): 23306
• RRID: AB_2879561
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14524
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.