TNF-alpha Monoclonal antibody, PBS Only

• 

  WB analysis using 60291-1-Ig (same clone as 60291-1-PBS)

  PMA, LPS, and Brefeldin A treated THP-1 cells were subjected to SDS PAGE followed by western blot with 60291-1-Ig (TNF Alpha antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with GAPDH Monoclonal antibody 60004-1-Ig as loading control. This data was developed using the same antibody clone with 60291-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 60291-1-Ig (same clone as 60291-1-PBS)

  WB result of TNF alpha antibody (60291-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TNF alpha transfected HeLa cells. This data was developed using the same antibody clone with 60291-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 60291-1-Ig (same clone as 60291-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60291-1-Ig (TNF Alpha antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60291-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 60291-1-Ig (same clone as 60291-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 60291-1-Ig (TNF Alpha antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60291-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 60291-1-Ig (same clone as 60291-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60291-1-Ig (TNF Alpha antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60291-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 60291-1-Ig (same clone as 60291-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 60291-1-Ig (TNF Alpha antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 60291-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human breast cancer using 60291-1-Ig (same clone as 60291-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using 60291-1-Ig (TNF alpha antibody) at dilution of 1:100 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60291-1-PBS in a different storage buffer formulation.

• 

  IF Staining of human breast cancer using 60291-1-Ig (same clone as 60291-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed human breast cancer tissue using 60291-1-Ig (TNF alpha antibody) at dilution of 1:100 and Alexa Fluor 488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 60291-1-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 60291-1-Ig (same clone as 60291-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed PMA, LPS and Brefeldin A treated THP-1 cells using TNF-alpha antibody (60291-1-Ig, Clone: 7B8A11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 60291-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TNF-alpha Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, Indirect ELISA

Cat No. 60291-1-PBS

Clone No.7B8A11

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, IF-P, Indirect ELISA

Synonyms

TNF, TNF alpha, TNF-a, 7B8A11, C-domain 1

---

Product Information

60291-1-PBS targets TNF-alpha in WB, IHC, IF/ICC, IF-P, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11413

  Product name: Recombinant human TNF-a protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-233 aa of BC028148

  Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

• Full Name: tumor necrosis factor (TNF superfamily, member 2)
• Calculated Molecular Weight: 233 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC028148
• Gene Symbol: TNF-alpha
• Gene ID (NCBI): 7124
• ENSEMBL Gene ID: ENSG00000232810
• RRID: AB_2833255
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P01375
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, INS resistance, and cancer.