• Featured Product
  • KD/KO Validated

TNF-alpha Monoclonal antibody, PBS Only

TNF-alpha Monoclonal Antibody for WB, Indirect ELISA
Cat No. 60291-1-PBS
Clone No.7B8A11

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat

Applications

WB, Indirect ELISA

TNF, TNF alpha, TNF-a, 7B8A11, C-domain 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

60291-1-PBS targets TNF-alpha in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11413

Product name: Recombinant human TNF-a protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-233 aa of BC028148

Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Predict reactive species
Full Name tumor necrosis factor (TNF superfamily, member 2)
Calculated Molecular Weight 233 aa, 26 kDa
Observed Molecular Weight26 kDa
GenBank Accession NumberBC028148
Gene Symbol TNF-alpha
Gene ID (NCBI) 7124
ENSEMBL Gene IDENSG00000232810
RRIDAB_2833255
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01375
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, INS resistance, and cancer.

Loading...
||
New chat

Able

正在加载,请稍候...