Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TNF-alpha Monoclonal antibody

TNF-alpha Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60291-1-Ig
Clone No.7B8A11

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (6)

Applications

WB, IHC, IF/ICC, RIP, ELISA

TNF, TNF alpha, TNF-a, 7B8A11, C-domain 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inPMA, LPS and Brefeldin A treated THP-1 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPMA, LPS and Brefeldin A treated THP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60291-1-Ig targets TNF-alpha in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, rabbit, monkey, chicken, bovine, duck
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11413

Product name: Recombinant human TNF-a protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-233 aa of BC028148

Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Predict reactive species
Full Name tumor necrosis factor (TNF superfamily, member 2)
Calculated Molecular Weight 233 aa, 26 kDa
Observed Molecular Weight26 kDa
GenBank Accession NumberBC028148
Gene Symbol TNF-alpha
Gene ID (NCBI) 7124
ENSEMBL Gene IDENSG00000232810
RRIDAB_2833255
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01375
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, INS resistance, and cancer.

Protocols

Product Specific Protocols
IF protocol for TNF-alpha antibody 60291-1-IgDownload protocol
IHC protocol for TNF-alpha antibody 60291-1-IgDownload protocol
WB protocol for TNF-alpha antibody 60291-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
IHC

Signal Transduct Target Ther

Metabolic reprogramming of proinflammatory macrophages by target delivered roburic acid effectively ameliorates rheumatoid arthritis symptoms

Authors - Na Jia
humanIHC

Nat Immunol

NKILA lncRNA promotes tumor immune evasion by sensitizing T cells to activation-induced cell death.

Authors - Di Huang
humanWB

Blood

The hepatocyte-specific HNF4α/miR-122 pathway contributes to iron overload-mediated hepatic inflammation.

Authors - Min Li
humanWB

ACS Nano

Hepatic Stellate Cell- and Liver Microbiome-Specific Delivery System for Dihydrotanshinone I to Ameliorate Liver Fibrosis

Authors - Xia Niu
WB

Nat Commun

Interventional hydrogel microsphere vaccine as an immune amplifier for activated antitumour immunity after ablation therapy

Authors - Xiaoyu Liu
IHC

Adv Sci (Weinh)

Inflammatory Fibroblast-Like Synoviocyte-Derived Exosomes Aggravate Osteoarthritis via Enhancing Macrophage Glycolysis

Authors - Bin Liu

Reviews

    4.0 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Udesh (Verified Customer) (04-19-2023)

Worked well for WB in U2OS cells at 1:1000. TNF-alpha observed in upper membrane part

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: U2OS
TNF-alpha Antibody Western Blot validation (1:1000 dilution) in U2OS (Cat no:60291-1-Ig)

Feng-Qian (Verified Customer) (12-07-2018)

Signal was very weak.

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1/250
  • Cell Tissue Type: HaCaT
Loading...
||
New chat

Able

正在加载,请稍候...