Tested Applications
| Positive WB detected in | PMA, LPS and Brefeldin A treated THP-1 cells |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PMA, LPS and Brefeldin A treated THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60291-1-Ig targets TNF-alpha in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig, rabbit, monkey, chicken, bovine, duck |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11413 Product name: Recombinant human TNF-a protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-233 aa of BC028148 Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL Predict reactive species |
| Full Name | tumor necrosis factor (TNF superfamily, member 2) |
| Calculated Molecular Weight | 233 aa, 26 kDa |
| Observed Molecular Weight | 26 kDa |
| GenBank Accession Number | BC028148 |
| Gene Symbol | TNF-alpha |
| Gene ID (NCBI) | 7124 |
| ENSEMBL Gene ID | ENSG00000232810 |
| RRID | AB_2833255 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P01375 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, INS resistance, and cancer.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TNF-alpha antibody 60291-1-Ig | Download protocol |
| IHC protocol for TNF-alpha antibody 60291-1-Ig | Download protocol |
| WB protocol for TNF-alpha antibody 60291-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
TNF-alpha Monoclonal antibody (7B8A11), catalog number 60291-1-Ig, has accumulated 807 citations. These appear in high-impact journals including Nature Communications, Nature Immunology, Advanced Materials, Theranostics, Biomaterials, Journal of Controlled Release, Acta Biomaterialia, and Phytomedicine, among many others. Associated research fields span inflammation and immune regulation, macrophage biology, wound healing, bone repair, liver disease, cardiovascular pathology, neuroinflammation, cancer, kidney disease, diabetes, ferroptosis, tissue engineering, and nanomedicine-based drug delivery.
| Species | Application | Title |
|---|---|---|
Signal Transduct Target Ther Metabolic reprogramming of proinflammatory macrophages by target delivered roburic acid effectively ameliorates rheumatoid arthritis symptoms | ||
Cell Metab Hexokinase 2 senses fructose in tumor-associated macrophages to promote colorectal cancer growth | ||
Exploration (Beijing) Caffeic Acid Acts as a Potent Senomorphic and Alleviates Inflammation and Lung Fibrosis by Covalently Targeting Annexin A5 Protein in Mice. | ||
Exploration (Beijing) An Ocular Surface-Targeting Nucleic Acid Hydrogel for Efficient Dry Eye Disease Treatment. | ||
Adv Mater Functionalized Nanozyme Microcapsules Targeting Deafness Prevention via Mitochondrial Homeostasis Remodeling | ||
Adv Mater Biocooperative Regenerative Materials by Harnessing Blood-Clotting and Peptide Self-Assembly |
Reviews
What customers say
Users report mixed results with this antibody. One reviewer (5/5) found it performed well for Western Blot in U2OS cells at a 1:1000 dilution, detecting TNF-alpha clearly. Another reviewer (3/5) reported very weak signal when using it for Western Blot and Immunofluorescence in HaCaT cells at a 1:250 dilution. Overall, performance appears to vary by cell type and application, with strong results in some contexts but weak signal in others.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Udesh (Verified Customer) (04-19-2023) | Worked well for WB in U2OS cells at 1:1000. TNF-alpha observed in upper membrane part
 |
Feng-Qian (Verified Customer) (12-07-2018) | Signal was very weak.
|
