Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TNF-alpha Monoclonal antibody

TNF-alpha Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 60291-1-Ig
Clone No. 7B8A11
Publications (800)
Reviews (2)
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

human and More (6)

Applications

WB, IHC, IF/ICC, RIP, ELISA

TNF, TNF alpha, TNF-a, 7B8A11, C-domain 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for TNF-alpha in ?

Tested Applications

Positive WB detected inPMA, LPS and Brefeldin A treated THP-1 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inPMA, LPS and Brefeldin A treated THP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:20000
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60291-1-Ig targets TNF-alpha in WB, IHC, IF/ICC, RIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, pig, rabbit, monkey, chicken, bovine, duck
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag11413

Product name: Recombinant human TNF-a protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-233 aa of BC028148

Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Predict reactive species
Full Name tumor necrosis factor (TNF superfamily, member 2)
Calculated Molecular Weight 233 aa, 26 kDa
Observed Molecular Weight26 kDa
GenBank Accession NumberBC028148
Gene Symbol TNF-alpha
Gene ID (NCBI) 7124
ENSEMBL Gene IDENSG00000232810
RRIDAB_2833255
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01375
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, INS resistance, and cancer.

Protocols

Product Specific Protocols
IF protocol for TNF-alpha antibody 60291-1-IgDownload protocol
IHC protocol for TNF-alpha antibody 60291-1-IgDownload protocol
WB protocol for TNF-alpha antibody 60291-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

TNF-alpha Monoclonal antibody (7B8A11), catalog number 60291-1-Ig, has accumulated 807 citations. These appear in high-impact journals including Nature Communications, Nature Immunology, Advanced Materials, Theranostics, Biomaterials, Journal of Controlled Release, Acta Biomaterialia, and Phytomedicine, among many others. Associated research fields span inflammation and immune regulation, macrophage biology, wound healing, bone repair, liver disease, cardiovascular pathology, neuroinflammation, cancer, kidney disease, diabetes, ferroptosis, tissue engineering, and nanomedicine-based drug delivery.

SpeciesApplicationTitle
IHC

Signal Transduct Target Ther

Metabolic reprogramming of proinflammatory macrophages by target delivered roburic acid effectively ameliorates rheumatoid arthritis symptoms

Authors - Na Jia
human

Cell Metab

Hexokinase 2 senses fructose in tumor-associated macrophages to promote colorectal cancer growth

Authors - Huiwen Yan
mouse,humanIHC

Exploration (Beijing)

Caffeic Acid Acts as a Potent Senomorphic and Alleviates Inflammation and Lung Fibrosis by Covalently Targeting Annexin A5 Protein in Mice.

Authors - Yinhua Zhu

Exploration (Beijing)

An Ocular Surface-Targeting Nucleic Acid Hydrogel for Efficient Dry Eye Disease Treatment.

Authors - Yuhe Liu
IF

Adv Mater

Functionalized Nanozyme Microcapsules Targeting Deafness Prevention via Mitochondrial Homeostasis Remodeling

Authors - Shengjie Ge
IHC

Adv Mater

Biocooperative Regenerative Materials by Harnessing Blood-Clotting and Peptide Self-Assembly

Authors - Soraya Padilla-Lopategui

Reviews

    4.0 out of 5
Add a review

2 verified customer reviews

What customers say

Users report mixed results with this antibody. One reviewer (5/5) found it performed well for Western Blot in U2OS cells at a 1:1000 dilution, detecting TNF-alpha clearly. Another reviewer (3/5) reported very weak signal when using it for Western Blot and Immunofluorescence in HaCaT cells at a 1:250 dilution. Overall, performance appears to vary by cell type and application, with strong results in some contexts but weak signal in others.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Udesh (Verified Customer) (04-19-2023)

Worked well for WB in U2OS cells at 1:1000. TNF-alpha observed in upper membrane part

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: U2OS
TNF-alpha Antibody Western Blot validation (1:1000 dilution) in U2OS (Cat no:60291-1-Ig)

Feng-Qian (Verified Customer) (12-07-2018)

Signal was very weak.

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1/250
  • Cell Tissue Type: HaCaT
Loading...
||
New chat

Able™

正在加载,请稍候...