TNF-alpha Polyclonal antibody

TNF-alpha Polyclonal Antibody for WB, IF/ICC, ELISA
Cat No. 17590-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (5)

Applications

WB, IHC, IF/ICC, ELISA, Cell treatment, Transwell Assay

TNF, TNF alpha, TNF-a, C-domain 1, C-domain 2

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inTHP-1 cells, LPS treated RAW 264.7 cells
Positive IF/ICC detected inPMA, LPS and Brefeldin A treated THP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

17590-1-AP targets TNF-alpha in WB, IHC, IF/ICC, ELISA, Cell treatment, Transwell Assay applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, rabbit, bovine, sheep, fish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag11433

Product name: Recombinant human TNF-a protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-233 aa of BC028148

Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Predict reactive species
Full Name tumor necrosis factor (TNF superfamily, member 2)
Calculated Molecular Weight 233 aa, 26 kDa
Observed Molecular Weight 26 kDa
GenBank Accession NumberBC028148
Gene Symbol TNF-alpha
Gene ID (NCBI) 7124
ENSEMBL Gene IDENSG00000232810
RRIDAB_2271853
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP01375
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TNF, as also known as TNF-alpha, or cachectin, is a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. It is expressed as a 26 kDa membrane bound protein and is then cleaved by TNF-alpha converting enzyme (TACE) to release the soluble 17 kDa monomer, which forms homotrimers in circulation. It is produced chiefly by activated macrophages, although it can be produced by many other cell types such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils, and neurons. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, ins resistance, and cancer.

Protocols

Product Specific Protocols
WB protocol for TNF-alpha antibody 17590-1-APDownload protocol
IF protocol for TNF-alpha antibody 17590-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Brain Behav Immun

HMGB1 mediates depressive behavior induced by chronic stress through activating the kynurenine pathway.

Authors - Bo Wang
mouseIHC

Bioact Mater

A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds

Authors - Shunlai Shang
mouseWB,IHC,IF

ACS Cent Sci

Macrophage Inactivation by Small Molecule Wedelolactone via Targeting sEH for the Treatment of LPS-Induced Acute Lung Injury

Authors - Juan Zhang
mouseWB

Adv Sci (Weinh)

3D Printing of a Vascularized Mini-Liver Based on the Size-Dependent Functional Enhancements of Cell Spheroids for Rescue of Liver Failure

Authors - Jiabin Zhang
mouseWB

Sci Adv

Citrulline regulates macrophage metabolism and inflammation to counter aging in mice

Authors - Zhangdan Xie
WB,IF

Small

M2 Macrophage Membrane-Mediated Biomimetic-Nanoparticle Carrying COX-siRNA Targeted Delivery for Prevention of Tendon Adhesions by Inhibiting Inflammation

Authors - Jie Sun

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Margarita (Verified Customer) (11-22-2023)

Prostate Cancer cell line, overnight incubation, Mouse

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: TRAMPC C2
TNF-alpha Antibody Immunofluorescence validation (1:100 dilution) in TRAMPC C2 (Cat no:17590-1-AP)
FH

Isha (Verified Customer) (09-20-2021)

signal was very good. My sample was renal tissue lysate after ischemia reperfusion

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:800
  • Cell Tissue Type: Kidney
Loading...
||
New chat Able
正在加载,请稍候...