Mouse TNFSF11/RANKL Recombinant monoclonal antibody, PBS Only

TNFSF11/RANKL Uni-rAb® Recombinant Antibody for WB, IHC, Indirect ELISA
Cat No. 84431-5-PBS
Clone No.241791B7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, Indirect ELISA

241791B7, CD254, ODF, OPGL, Osteoclast differentiation factor

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84431-5-PBS targets TNFSF11/RANKL in WB, IHC, Indirect ELISA applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1956

Product name: Recombinant Mouse TNFSF11/RANKL protein (rFc Tag)(HPLC verified)

Source: mammalian cells-derived, pHZ-KIsec-N-rFc

Tag: N-rFc

Domain: 72-316 aa of NM_011613.3

Sequence: RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Predict reactive species
Full Name tumor necrosis factor (ligand) superfamily, member 11
Calculated Molecular Weight35KD
Observed Molecular Weight22 kDa
GenBank Accession NumberNM_011613.3
Gene Symbol Tnfsf11
Gene ID (NCBI) 21943
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDO35235
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TNFSF11, known as Tumor Necrosis Factor Superfamily Member 11, also known as RANKL (Receptor Activator of Nuclear Factor-κB Ligand), TRANCE, etc., is a member of the Tumor Necrosis Factor (TNF) superfamily.RANKL is a type II homotrimeric transmembrane protein located primarily at the plasma membrane. RANKL is a type II homotrimeric transmembrane protein located mainly at the plasma membrane, and in addition to the membrane-bound form (mRNAKL), it can also be cleaved by proteolytic cleavage of the cell membrane to produce the soluble form (sRANKL). The membrane-bound form of RANKL is the main form involved in triggering the RANKL/RANK signaling pathway and mediating osteoclastogenesis. Current studies have shown that TNFSF11 acts primarily in the immune and skeletal systems and has been implicated in the pathogenesis of degenerative bone diseases, carcinogenesis, and asthma.

Loading...
||
New chat

Able

正在加载,请稍候...