Mouse TNFSF11/RANKL Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84431-5-RR (same clone as 84431-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84431-5-RR (TNFSF11 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84431-5-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse spleen using 84431-5-RR (same clone as 84431-5-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84431-5-RR (TNFSF11 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84431-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84431-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84431-5-RR against Mouse TNFSF11 were performed. The affinity constant is 9.78 nM.

TNFSF11/RANKL Uni-rAb^® Recombinant Antibody for WB, IHC, Indirect ELISA

Cat No. 84431-5-PBS

Clone No.241791B7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

241791B7, CD254, ODF, OPGL, Osteoclast differentiation factor

---

Product Information

84431-5-PBS targets TNFSF11/RANKL in WB, IHC, Indirect ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1956

  Product name: Recombinant Mouse TNFSF11/RANKL protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 72-316 aa of NM_011613.3

  Sequence: RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

• Full Name: tumor necrosis factor (ligand) superfamily, member 11
• Calculated Molecular Weight: 35KD
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: NM_011613.3
• Gene Symbol: Tnfsf11
• Gene ID (NCBI): 21943
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O35235
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TNFSF11, known as Tumor Necrosis Factor Superfamily Member 11, also known as RANKL (Receptor Activator of Nuclear Factor-κB Ligand), TRANCE, etc., is a member of the Tumor Necrosis Factor (TNF) superfamily.RANKL is a type II homotrimeric transmembrane protein located primarily at the plasma membrane. RANKL is a type II homotrimeric transmembrane protein located mainly at the plasma membrane, and in addition to the membrane-bound form (mRNAKL), it can also be cleaved by proteolytic cleavage of the cell membrane to produce the soluble form (sRANKL). The membrane-bound form of RANKL is the main form involved in triggering the RANKL/RANK signaling pathway and mediating osteoclastogenesis. Current studies have shown that TNFSF11 acts primarily in the immune and skeletal systems and has been implicated in the pathogenesis of degenerative bone diseases, carcinogenesis, and asthma.