TNFSF11/RANKL Recombinant monoclonal antibody

• 

  WB analysis using 84431-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 84431-5-RR (TNFSF11 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse spleen using 84431-5-RR

  Immunohistochemical analysis of paraffin-embedded mouse spleen tissue slide using 84431-5-RR (TNFSF11 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 84431-5-RR

  Biolayer interferometry (BLl) kinetic assays of 84431-5-RR against Mouse TNFSF11 were performed. The affinity constant is 9.78 nM.

TNFSF11/RANKL Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 84431-5-RR

Clone No.241791B7

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, IHC, ELISA

Synonyms

241791B7, CD254, ODF, OPGL, Osteoclast differentiation factor

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, mouse liver tissue
• Positive IHC detected in: mouse spleen tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

84431-5-RR targets TNFSF11/RANKL in WB, IHC, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1956

  Product name: Recombinant Mouse TNFSF11/RANKL protein (rFc Tag)(HPLC verified)

  Source: mammalian cells-derived, pHZ-KIsec-N-rFc

  Tag: N-rFc

  Domain: 72-316 aa of NM_011613.3

  Sequence: RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

• Full Name: tumor necrosis factor (ligand) superfamily, member 11
• Calculated Molecular Weight: 35KD
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: NM_011613.3
• Gene Symbol: Tnfsf11
• Gene ID (NCBI): 21943
• RRID: AB_3671958
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: O35235
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TNFSF11, known as Tumor Necrosis Factor Superfamily Member 11, also known as RANKL (Receptor Activator of Nuclear Factor-κB Ligand), TRANCE, etc., is a member of the Tumor Necrosis Factor (TNF) superfamily.RANKL is a type II homotrimeric transmembrane protein located primarily at the plasma membrane. RANKL is a type II homotrimeric transmembrane protein located mainly at the plasma membrane, and in addition to the membrane-bound form (mRNAKL), it can also be cleaved by proteolytic cleavage of the cell membrane to produce the soluble form (sRANKL). The membrane-bound form of RANKL is the main form involved in triggering the RANKL/RANK signaling pathway and mediating osteoclastogenesis. Current studies have shown that TNFSF11 acts primarily in the immune and skeletal systems and has been implicated in the pathogenesis of degenerative bone diseases, carcinogenesis, and asthma.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Exp Cell Res; Activated NETosis of bone marrow neutrophils up-regulates macrophage osteoclastogenesis via cGAS-STING/AKT2 pathway to promote osteoporosis; Authors - Yutong Guo