TRIM24 Polyclonal antibody

• 

  WB analysis of HeLa using 14208-1-AP

  WB result of TRIM24 antibody (14208-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-TRIM24 transfected HeLa cells.

• 

  WB analysis using 14208-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14208-1-AP (TRIM24 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 14208-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14208-1-AP (TRIM24 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of BGC-823 using 14208-1-AP

  BGC-823 cells were subjected to SDS PAGE followed by western blot with 14208-1-AP (TRIM24 Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 14208-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 14208-1-AP (TRIM24 Antibody) at dilution of 1:1500 incubated at 4 degree celsius over night.

• 

  WB analysis of L02 using 14208-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 14208-1-AP (TRIM24 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 14208-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 14208-1-AP (TRIM24 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse skeletal muscle using 14208-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 14208-1-AP (TRIM24 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 14208-1-AP

  IP result of anti-TRIM24 (IP:14208-1-AP, 4ug; Detection:14208-1-AP 1:6000) with HeLa cells lysate 1085 ug.

• 

  IHC staining of human prostate cancer using 14208-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 14208-1-AP (TRIM24 antibody) at dilution of 1:100 (under 10x lens).

• 

  IHC staining of human prostate cancer using 14208-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 14208-1-AP (TRIM24 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HeLa using 14208-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using TRIM24 antibody (14208-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

TRIM24 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14208-1-AP

Publications(47)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA

Synonyms

TIF1-alpha, TIF1A, TIF1, RING-type E3 ubiquitin transferase TIF1-alpha, EC:2.3.2.27

---

Tested Applications

• Positive WB detected in: HeLa cells, L02 cells, BGC-823 cells, human heart tissue, mouse skeletal muscle tissue, MCF-7 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 14 publications below
• WB: See 36 publications below
• IHC: See 18 publications below
• IF: See 8 publications below
• IP: See 5 publications below
• CoIP: See 1 publications below
• ChIP: See 5 publications below
• RIP: See 1 publications below

Product Information

14208-1-AP targets TRIM24 in WB, IHC, IF/ICC, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5417

  Product name: Recombinant human TRIM24 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 701-1050 aa of BC028689

  Sequence: SKPAGADSTHKVPVVMLEPIRIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRSDAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK

• Full Name: tripartite motif-containing 24
• Calculated Molecular Weight: 117 kDa
• Observed Molecular Weight: 117 kDa
• GenBank Accession Number: BC028689
• Gene Symbol: TRIM24
• Gene ID (NCBI): 8805
• RRID: AB_2256646
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15164
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRIM24, also named as RNF82, TIF1 and TIF1A, interacts selectively in vitro with the AF2-activating domain of the estrogen receptors. Association with DNA-bound estrogen receptors, it requires the presence of estradiol. It is a regulation protein of P53. Defects in TRIM24 are a cause of thyroid papillary carcinoma (TPC) wich is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Nature; TRIM24 links a non-canonical histone signature to breast cancer.; Authors - Tsai Wen-Wei WW
human	WB,CoIP	Mol Cell; p53 engages the cGAS/STING cytosolic DNA sensing pathway for tumor suppression; Authors - Monisankar Ghosh ; KD Validated
human	WB	Mol Cell; TRIP12 promotes small-molecule-induced degradation through K29/K48-branched ubiquitin chains.; Authors - Ai Kaiho-Soma
human	WB	Nat Chem Biol; Functional TRIM24 degrader via conjugation of ineffectual bromodomain and VHL ligands.; Authors - Lara N Gechijian
human	WB, IP, IHC	Nat Commun; TRIM24 is an oncogenic transcriptional co-activator of STAT3 in glioblastoma.; Authors - Deguan Lv
human	WB,IF	Nat Commun; Identification of proximal SUMO-dependent interactors using SUMO-ID.; Authors - Orhi Barroso-Gomila

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Parijat (Verified Customer) (09-20-2023)

Good antibody for Western

• Applications: Western Blot