CoraLite® Plus 488-conjugated TRIM24 Polyclonal antibody

• 

  IF Staining of HeLa using CL488-14208

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CoraLite® Plus 488 TRIM24 antibody (CL488-14208) at dilution of 1:200, CL594-Phalloidin (red).

• 

  FC experiment of HeLa using CL488-14208

  1x10^6 HeLa cells were intracellularly stained with 0.8 ug CoraLite® Plus 488-conjugated TRIM24 Polyclonal antibody (CL488-14208)(red), or 0.8 ug CoraLite® Plus 488-conjugated Rabbit IgG control Rabbit PolyAb (CL488-30000) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

TRIM24 Polyclonal Antibody for IF/ICC, FC (Intra)

Cat No. CL488-14208

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Synonyms

TRIM24, tripartite motif containing 24, Tripartite motif containing protein 24, Tripartite motif-containing protein 24, E3 ubiquitin-protein ligase TRIM24, EC:2.3.2.27, RING-type E3 ubiquitin transferase TIF1-alpha, TIF1, TIF1A, TIF1-alpha, Transcription intermediary factor 1-alpha, TRIM, TRIM 24

---

Tested Applications

• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells
• Positive FC detected in: HeLa cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
• Flow Cytometry (FC): FC : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-14208 targets TRIM24 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5417

  Product name: Recombinant human TRIM24 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 701-1050 aa of BC028689

  Sequence: SKPAGADSTHKVPVVMLEPIRIKQENSGPPENYDFPVVIVKQESDEESRPQNANYPRSILTSLLLNSSQSSTSEETVLRSDAPDSTGDQPGLHQDNSSNGKSEWLDPSQKSPLHVGETRKEDDPNEDWCAVCQNGGELLCCEKCPKVFHLSCHVPTLTNFPSGEWICTFCRDLSKPEVEYDCDAPSHNSEKKKTEGLVKLTPIDKRKCERLLLFLYCHEMSLAFQDPVPLTVPDYYKIIKNPMDLSTIKKRLQEDYSMYSKPEDFVADFRLIFQNCAEFNEPDSEVANAGIKLENYFEELLKNLYPEKRFPKPEFRNESEDNKFSDDSDDDFVQPRKKRLKSIEERQLLK

• Full Name: tripartite motif-containing 24
• Calculated Molecular Weight: 117 kDa
• Observed Molecular Weight: 117 kDa
• GenBank Accession Number: BC028689
• Gene Symbol: TRIM24
• Gene ID (NCBI): 8805
• RRID: AB_3672584
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15164
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

TRIM24, also named as RNF82, TIF1 and TIF1A, interacts selectively in vitro with the AF2-activating domain of the estrogen receptors. Association with DNA-bound estrogen receptors, it requires the presence of estradiol. It is a regulation protein of P53. Defects in TRIM24 are a cause of thyroid papillary carcinoma (TPC) wich is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue.