TTDN1 Polyclonal antibody

TTDN1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 25410-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

C7orf11, ABHS, TTD non-photosensitive 1 protein, ORF20, MPLKIP

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells
Positive IHC detected inhuman intrahepatic cholangiocarcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25410-1-AP targets TTDN1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22094

Product name: Recombinant human C7orf11 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-179 aa of BC026265

Sequence: MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRPYGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTSTPFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC

Predict reactive species
Full Name chromosome 7 open reading frame 11
Calculated Molecular Weight 179 aa, 19 kDa
Observed Molecular Weight23 kDa
GenBank Accession NumberBC026265
Gene Symbol TTDN1
Gene ID (NCBI) 136647
RRIDAB_2935461
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8TAP9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TTDN1 colocalizes with Plk1 at the centrosome in mitosis and the midbody during cytokinesis. It is phosphorylated by Cdk1 in mitosis, and this is required for its interaction with Plk1. Overexpression of TTDN1 or its knockdown by siRNA causes multi-polar spindles and multiple nuclei, suggesting that TTDN1 plays a role in regulating mitosis and cytokinesis. Mutations in the TTDN1 gene are associated with a distinct trichothiodystrophy phenotype. (PMID:17310276, 25290684)

Protocols

Product Specific Protocols
WB protocol for TTDN1 antibody 25410-1-APDownload protocol
IHC protocol for TTDN1 antibody 25410-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Aleksandr (Verified Customer) (07-19-2025)

Antibodies were used for Ttdn1 detection in RKO cells! Incubation overnight at 4C

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: RKO
TTDN1 Antibody Western Blot validation (1:2000 dilution) in RKO (Cat no:25410-1-AP)
FH

Moritz (Verified Customer) (08-20-2024)

I used this antibody to detect MPLKIP/TTDN1 with Western blot in HEK293T WT cell lysate, which worked perfectly.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: HEK293T WT
TTDN1 Antibody Western Blot validation (1:3000 dilution) in HEK293T WT (Cat no:25410-1-AP)
FH

Tsimafei (Verified Customer) (08-12-2024)

Antibody detect a band in the range between 20-25 kDa

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: mESCs
TTDN1 Antibody Western Blot validation (1:3000 dilution) in mESCs (Cat no:25410-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...