• Featured Product
  • KD/KO Validated

Thymidylate synthase Polyclonal antibody

Thymidylate synthase Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 15047-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

TYMS, DKCD, EC:2.1.1.45, HsT422, OK/SW-cl.29

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293T cells, HEK-293 cells, MCF-7 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman endometrial cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:5000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15047-1-AP targets Thymidylate synthase in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7027

Product name: Recombinant human TYMS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-313 aa of BC002567

Sequence: MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV

Predict reactive species
Full Name thymidylate synthetase
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 32-36 kDa
GenBank Accession NumberBC002567
Gene Symbol TYMS
Gene ID (NCBI) 7298
RRIDAB_2210721
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04818
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Thymidylate synthase gene (TYMS) encodes thymidylate synthase (TS) which is an important factor in the growth of tumor cells. TS can catalyze the transformation of intracellular uridine monophosphate (dump) into dTMP which is required for DNA replication and repairing. TS is a key enzyme in the process of cell proliferation, also is the important target enzymes of 5-FU and other chemotherapy drugs. The expression of TYMS is negatively correlated with the efficacy of chemotherapy and the prognosis of patients who suffer from rectal cancer, breast cancer, colorectal cancer, gastric cancer, head and neck cancer, esophageal cancer, pancreatic cancer and so on.

Protocols

Product Specific Protocols
IF protocol for Thymidylate synthase antibody 15047-1-APDownload protocol
IHC protocol for Thymidylate synthase antibody 15047-1-APDownload protocol
IP protocol for Thymidylate synthase antibody 15047-1-APDownload protocol
WB protocol for Thymidylate synthase antibody 15047-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Pineal Res

Melatonin modulates metabolic remodeling in HNSCC by suppressing MTHFD1L-formate axis.

Authors - Li Cui

Nat Commun

CETSA screening identifies known and novel thymidylate synthase inhibitors and slow intracellular activation of 5-fluorouracil.

Authors - Helena Almqvist
humanWB

Cancer Res

5-Fluorouracil Enhances the Antitumor Activity of the Glutaminase Inhibitor CB-839 against PIK3CA-Mutant Colorectal Cancers.

Authors - Yiqing Zhao
humanWB

Cell Rep

The mTORC1 Signaling Network Senses Changes in Cellular Purine Nucleotide Levels.

Authors - Gerta Hoxhaj
humanWB

Cell Chem Biol

CETSA interaction proteomics define specific RNA-modification pathways as key components of fluorouracil-based cancer drug cytotoxicity.

Authors - Ying Yu Liang
humanWB

Oxid Med Cell Longev

lncRNA IGF2-AS Regulates Nucleotide Metabolism by Mediating HMGA1 to Promote Pyroptosis of Endothelial Progenitor Cells in Sepsis Patients.

Authors - Guibin Liang
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...