• Featured Product
  • KD/KO Validated

CoraLite®555-conjugated Thymidylate synthase Polyclonal antibody

Thymidylate synthase Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL555-15047

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

TYMS, TMS, thymidylate synthetase, OK/SW-cl.29, HsT422

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL555-15047 targets Thymidylate synthase in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7027

Product name: Recombinant human TYMS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-313 aa of BC002567

Sequence: MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV

Predict reactive species
Full Name thymidylate synthetase
Calculated Molecular Weight 36 kDa
Observed Molecular Weight 32-36 kDa
GenBank Accession NumberBC002567
Gene Symbol TYMS
Gene ID (NCBI) 7298
RRIDAB_2919622
Conjugate CoraLite®555 Fluorescent Dye
Excitation/Emission Maxima Wavelengths557 nm / 570 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04818
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Thymidylate synthase gene (TYMS) encodes thymidylate synthase (TS) which is an important factor in the growth of tumor cells. TS can catalyze the transformation of intracellular uridine monophosphate (dump) into dTMP which is required for DNA replication and repairing. TS is a key enzyme in the process of cell proliferation, also is the important target enzymes of 5-FU and other chemotherapy drugs. The expression of TYMS is negatively correlated with the efficacy of chemotherapy and the prognosis of patients who suffer from rectal cancer, breast cancer, colorectal cancer, gastric cancer, head and neck cancer, esophageal cancer, pancreatic cancer and so on.

Protocols

Product Specific Protocols
IF protocol for CL555 Thymidylate synthase antibody CL555-15047Download protocol
FC protocol for CL555 Thymidylate synthase antibody CL555-15047Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...