UBE2T/HSPC150 Polyclonal antibody

• 

  WB analysis of HeLa using 10105-2-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10105-2-AP (UBE2T/HSPC150 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10105-2-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10105-2-AP (UBE2T/HSPC150 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 10105-2-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 10105-2-AP (UBE2T/HSPC150 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of K-562 using 10105-2-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 10105-2-AP (UBE2T/HSPC150 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 10105-2-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10105-2-AP (UBE2T/HSPC150 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10105-2-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10105-2-AP (UBE2T/HSPC150 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 10105-2-AP

  IP result of anti-UBE2T/HSPC150 (IP:10105-2-AP, 3ug; Detection:10105-2-AP 1:500) with HeLa cells lysate 3000ug.

• 

  IF Staining of HepG2 using 10105-2-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using UBE2T/HSPC150 antibody (10105-2-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

UBE2T/HSPC150 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 10105-2-AP

Publications(23)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

HSPC150, UBE2T, PIG50, EC:2.3.2.23, E2 ubiquitin-conjugating enzyme T

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, Jurkat cells, SKOV-3 cells
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 19 publications below
• IHC: See 11 publications below
• IF: See 2 publications below
• IP: See 1 publications below

Product Information

10105-2-AP targets UBE2T/HSPC150 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0153

  Product name: Recombinant human UBE2T protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-190 aa of BC004152

  Sequence: QRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIE

• Full Name: ubiquitin-conjugating enzyme E2T (putative)
• Calculated Molecular Weight: 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC004152
• Gene Symbol: UBE2T
• Gene ID (NCBI): 29089
• RRID: AB_2211478
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NPD8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The ubiquitin (Ub)-mediated protein degradation pathway involves three sequential enzymatic steps that facilitate the conjugation of Ub to specific protein substrates. The first step requires ATP-dependent activation of the C-terminus of Ub and the assembly of multi-Ubs by Ub-activating enzyme E1. The ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain, is then conjugated to Ubs, through a thiol-ester linkage between a conserved cysteine and the C-terminus of Ub, to generate an intermediate Ub-E2 complex. Then the E3, a ligase, catalyzes the transfer of Ub from E2 to the appropriate substrate. This pathway regulates many fundamental cellular processes. There are also other E2s which form thiol-ester linkages without the use of E3s as well as several UBC homologs (TSG101, Mms2, Croc-1 and similar proteins), which lack the active site cysteine essential for ubiquitination and appear to function in DNA repair pathways.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Am J Hum Genet; Mutations in the Gene Encoding the E2 Conjugating Enzyme UBE2T Cause Fanconi Anemia.; Authors - Asuka Hira
human	WB	Cancer Res; Proteasome function is required for DNA damage response and fanconi anemia pathway activation.; Authors - Céline Jacquemont
human	WB	Blood Adv; Amplification and overexpression of E2 ubiquitin conjugase UBE2T promotes homologous recombination in multiple myeloma.; Authors - David A Alagpulinsa
human	WB,IHC	Oncotarget; UBE2T promotes nasopharyngeal carcinoma cell proliferation, invasion, and metastasis by activating the AKT/GSK3β/β-catenin pathway.; Authors - Wei Hu ; KD Validated
human	WB	Biomed Pharmacother; Affinity-based protein profiling to reveal targets of puerarin involved in its protective effect on cardiomyocytes.; Authors - Shuai Huang
		Tumour Biol; Ubiquitin-Conjugating Enzyme E2T is an Independent Prognostic Factor and Promotes Gastric Cancer Progression.; Authors - Hao Yu