• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated UBE2T/HSPC150 Polyclonal antibody

UBE2T/HSPC150 Polyclonal Antibody for IF/ICC
Cat No. CL488-10105

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

HSPC150, PIG50, UBE2T, Ubiquitin carrier protein T, Ubiquitin protein ligase T

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10105 targets UBE2T/HSPC150 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0153

Product name: Recombinant human UBE2T protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-190 aa of BC004152

Sequence: QRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRFLTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFLKNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIE

Predict reactive species
Full Name ubiquitin-conjugating enzyme E2T (putative)
Calculated Molecular Weight 23 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC004152
Gene Symbol UBE2T
Gene ID (NCBI) 29089
RRIDAB_3083863
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NPD8
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The ubiquitin (Ub)-mediated protein degradation pathway involves three sequential enzymatic steps that facilitate the conjugation of Ub to specific protein substrates. The first step requires ATP-dependent activation of the C-terminus of Ub and the assembly of multi-Ubs by Ub-activating enzyme E1. The ubiquitin-conjugating enzyme E2, catalytic (UBCc) domain, is then conjugated to Ubs, through a thiol-ester linkage between a conserved cysteine and the C-terminus of Ub, to generate an intermediate Ub-E2 complex. Then the E3, a ligase, catalyzes the transfer of Ub from E2 to the appropriate substrate. This pathway regulates many fundamental cellular processes. There are also other E2s which form thiol-ester linkages without the use of E3s as well as several UBC homologs (TSG101, Mms2, Croc-1 and similar proteins), which lack the active site cysteine essential for ubiquitination and appear to function in DNA repair pathways.

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 UBE2T/HSPC150 antibody CL488-10105Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...