• Featured Product
  • KD/KO Validated

UBE4A Polyclonal antibody

UBE4A Polyclonal Antibody for WB, IP, ELISA
Cat No. 21548-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

E4, KIAA0126, UBE4A, UBOX2, UFD2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, mouse brain tissue, L02 cells, Jurkat cells, HepG2 cells
Positive IP detected inmouse brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21548-1-AP targets UBE4A in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16211

Product name: Recombinant human UBE4A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 717-1066 aa of BC112367

Sequence: QLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYRESIKDLADYASKNLEAMNPPLFLRFLNLLMNDAIFLLDEAIQYLSKIKIQQIEKDRGEWDSLTPEARREKEAGLQMFGQLARFHNIMSNETIGTLAFLTSEIKSLFVHPFLAERIISMLNYFLQHLVGPKMGALKVKDFSEFDFKPQQLVSDICTIYLNLGDEENFCATVPKDGRSYSPTLFAQTVRVLKKINKPGNMIMAFSNLAERIKSLADLQQQEEETYADACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQKEQLE

Predict reactive species
Full Name ubiquitination factor E4A (UFD2 homolog, yeast)
Calculated Molecular Weight 1073 aa, 124 kDa
Observed Molecular Weight 123 kDa
GenBank Accession NumberBC112367
Gene Symbol UBE4A
Gene ID (NCBI) 9354
RRIDAB_10755303
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14139
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IP protocol for UBE4A antibody 21548-1-APDownload protocol
WB protocol for UBE4A antibody 21548-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Mol Cell

RNF126-Mediated Reubiquitination Is Required for Proteasomal Degradation of p97-Extracted Membrane Proteins.

Authors - Xianyan Hu
humanWB

Biochim Biophys Acta Gene Regul Mech

UBE4A catalyzes NRF1 ubiquitination and facilitates DDI2-mediated NRF1 cleavage

Authors - Xianyan Hu
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...