UBE4A Polyclonal antibody

• 

  WB analysis of HEK-293 using 21548-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21548-1-AP (UBE4A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 21548-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 21548-1-AP (UBE4A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 21548-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21548-1-AP (UBE4A antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 21548-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 21548-1-AP (UBE4A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 21548-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 21548-1-AP (UBE4A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 21548-1-AP

  IP result of anti-UBE4A (IP:21548-1-AP, 4ug; Detection:21548-1-AP 1:500) with mouse brain tissue lysate 4000ug.

• Featured Product
• KD/KO Validated

UBE4A Polyclonal Antibody for WB, IP, ELISA

Cat No. 21548-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IP, ELISA

Synonyms

E4, KIAA0126, UBE4A, UBOX2, UFD2

---

Tested Applications

• Positive WB detected in: HEK-293 cells, mouse brain tissue, L02 cells, Jurkat cells, HepG2 cells
• Positive IP detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below

Product Information

21548-1-AP targets UBE4A in WB, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16211

  Product name: Recombinant human UBE4A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 717-1066 aa of BC112367

  Sequence: QLAEALIKVFVDIEFTGDPHQFEQKFNYRRPMYPILRYMWGTDTYRESIKDLADYASKNLEAMNPPLFLRFLNLLMNDAIFLLDEAIQYLSKIKIQQIEKDRGEWDSLTPEARREKEAGLQMFGQLARFHNIMSNETIGTLAFLTSEIKSLFVHPFLAERIISMLNYFLQHLVGPKMGALKVKDFSEFDFKPQQLVSDICTIYLNLGDEENFCATVPKDGRSYSPTLFAQTVRVLKKINKPGNMIMAFSNLAERIKSLADLQQQEEETYADACDEFLDPIMSTLMCDPVVLPSSRVTVDRSTIARHLLSDQTDPFNRSPLTMDQIRPNTELKEKIQRWLAERKQQKEQLE

• Full Name: ubiquitination factor E4A (UFD2 homolog, yeast)
• Calculated Molecular Weight: 1073 aa, 124 kDa
• Observed Molecular Weight: 123 kDa
• GenBank Accession Number: BC112367
• Gene Symbol: UBE4A
• Gene ID (NCBI): 9354
• RRID: AB_10755303
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14139
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; RNF126-Mediated Reubiquitination Is Required for Proteasomal Degradation of p97-Extracted Membrane Proteins.; Authors - Xianyan Hu
human	WB	Biochim Biophys Acta Gene Regul Mech; UBE4A catalyzes NRF1 ubiquitination and facilitates DDI2-mediated NRF1 cleavage; Authors - Xianyan Hu ; KD Validated