UBFD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UBFD1 Polyclonal antibody (32161-1-AP)

• 

  WB analysis using 32161-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32161-1-AP (UBFD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of ROS1728 using 32161-1-AP

  Immunofluorescent analysis of (4% PFA) fixed ROS1728 cells using UBFD1 antibody (32161-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

UBFD1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 32161-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

Ubiquitin domain-containing protein UBFD1, Ubiquitin Family Domain Containing 1 , Ubiquitin-binding protein homolog

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, Jurkat cells, NIH/3T3 cells
• Positive IF/ICC detected in: ROS1728 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32161-1-AP targets UBFD1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36361

  Product name: Recombinant human UBFD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-270 aa of NM_019116

  Sequence: MAAAGAPDGMEEPGMDTEAETVATEAPARPVNCLEAEAAAGAAAEDSGAARGSLQPAPAQPPGDPAAQASVSNGEDAGGGAGRELVDLKIIWNKTKHDVKFPLDSTGSELKQKIHSITGLPPAMQKVMYKGLVPEDKTLREIKVTSGAKIMVVGSTINDVLAVNTPKDAAQQDAKAEENKKEPLCRQKQHRKVLDKGKPEDVMPSVKGAQERLPTVPLSGMYNKSGGKVRLTFKLEQDQLWIGTKERTEKLPMGSIKNVVSEPIEGHEDY

• Full Name: ubiquitin family domain containing 1
• Calculated Molecular Weight: 309aa, 33 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: NM_019116
• Gene Symbol: UBFD1
• Gene ID (NCBI): 56061
• RRID: AB_3742534
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O14562
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UBFD1 (Ubiquitin Family Domain Containing 1) is a polyubiquitin-binding protein containing ubiquitin-like structural domains that are widely involved in protein degradation and cell signaling. This protein shows aberrant expression in a variety of cancers, especially in estrogen receptor (ER)-positive breast cancer, where high expression of UBFD1 is closely associated with poor prognosis of patients, and is considered as a potential prognostic biomarker and therapeutic target. In addition, UBFD1 was also found to be associated with MYC-mediated tumor aggressiveness in T-cell acute lymphoblastic leukemia (T-ALL), which functionally involves the endoplasmic reticulum-associated degradation (ERAD) pathway. UBFD1 is also expressed in inner ear hair cells and ear epithelial cells, suggesting that it may play a role in hearing-related diseases.