ULBP1 Polyclonal antibody

• 

  WB analysis of HEK-293 using 17715-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 17715-1-AP (ULBP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 17715-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 17715-1-AP (ULBP1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

ULBP1 Polyclonal Antibody for WB, ELISA

Cat No. 17715-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

Synonyms

ALCAN beta, N2DL 1, N2DL1, NKG2D ligand 1, NKG2DL1, RAET1I, UL16 binding protein 1, ULBP1

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 7 publications below
• IHC: See 2 publications below
• IF: See 3 publications below

Product Information

17715-1-AP targets ULBP1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12079

  Product name: Recombinant human ULBP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 26-244 aa of BC035416

  Sequence: GWVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMSCEHEAHGHGRGSWQFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMWLEEFLMYWEQMLDPTKPPSLAPGTTQPKAMATTLSPWSLLIIFLCFILAGR

• Full Name: UL16 binding protein 1
• Calculated Molecular Weight: 244 aa, 28 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC035416
• Gene Symbol: ULBP1
• Gene ID (NCBI): 80329
• RRID: AB_2214685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZM6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Lett; Pleckstrin-2 promotes tumour immune escape from NK cells by activating the MT1-MMP-MICA signalling axis in gastric cancer; Authors - Deli Mao
human	IF	ACS Biomater Sci Eng; Engineered Three-Dimensional Tumor Models to Study Natural Killer Cell Suppression.; Authors - Madison N Temples
mouse	WB	Cancer Biol Med; The PI3K/Akt/GSK-3β/ROS/eIF2B pathway promotes breast cancer growth and metastasis via suppression of NK cell cytotoxicity and tumor cell susceptibility.; Authors - Fengjiao Jin
human	WB	Mol Neurobiol; Exosomes Derived from Meningitic Escherichia coli-Infected Brain Microvascular Endothelial Cells Facilitate Astrocyte Activation; Authors - Ruicheng Yang
human	WB	Int Immunopharmacol; Venetoclax enhances NK cell killing sensitivity of AML cells through the NKG2D/NKG2DL activation pathway.; Authors - Hui-Yang Wu
human	WB	Gene; Identification of a potential signature to predict the risk of postmenopausal osteoporosis; Authors - Yannan Geng