ULBP3 Polyclonal antibody

• 

  WB analysis using 30058-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30058-1-AP (ULBP3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

ULBP3 Polyclonal Antibody for WB, ELISA

Cat No. 30058-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, ELISA

Synonyms

ALCAN gamma, N2DL 3, N2DL3, NKG2D ligand 3, NKG2DL3, RAET1N, UL16 binding protein 3, ULBP3

---

Tested Applications

• Positive WB detected in: HeLa cells, MDA-MB-231 cells, SW480 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30058-1-AP targets ULBP3 in WB, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32424

  Product name: Recombinant human ULBP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-150 aa of

  Sequence: DAHSLWYNFTIIHLPRHGQQWCEVQSQVDQKNFLSYDCGSDKVLSMGHLEEQLYATDAWGKQLEMLREVGQRLRLELADTELEDFTPSGPLTLQVRMSCECEADGYIRGSWQFSFDGRKFL

• Full Name: UL16 binding protein 3
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 28 kDa
• Gene Symbol: ULBP3
• Gene ID (NCBI): 79465
• RRID: AB_3086222
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BZM4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ULBP3 (UL16 binding protein-3), a class 1 major histocompatibility complex-like (MHC-like) molecule and member of the family of ligands of the killer cell lectin-like receptor subfamily K member 1 (NKG2D) (PMID:31292299). ULBP3 are expressed at the cell surface of multiple types of cells and tissues as a glycosylphosphatidylinositol (GPI)-linked proteins (PMID:22741585).