UQCRC2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• UQCRC2 Polyclonal antibody (14742-1-AP)

• Featured Product
• KD/KO Validated

UQCRC2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14742-1-AP Copied!

Publications (152)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA
For FC, select conjugated version.

Synonyms

Complex III subunit 2, Core protein II, Cytochrome b-c1 complex subunit 2, mitochondrial, QCR2, Ubiquinol-cytochrome-c reductase complex core protein 2

• 

  WB analysis using 14742-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14742-1-AP (UQCRC2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human colon using 14742-1-AP

  human colon tissue were subjected to SDS PAGE followed by western blot with 14742-1-AP (UQCRC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 14742-1-AP

  IP result of anti-UQCRC2 (IP:14742-1-AP, 4ug; Detection:14742-1-AP 1:40000) with HeLa cells lysate 1320 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 14742-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14742-1-AP (UQCRC2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 14742-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14742-1-AP (UQCRC2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 14742-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 14742-1-AP (UQCRC2 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 14742-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 14742-1-AP (UQCRC2 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L); Phalloidin stains F-actin (Red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 14742-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using UQCRC2 antibody (14742-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 14742-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 14742-1-AP (UQCRC2 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for UQCRC2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human colon tissue, mouse heart tissue, rat heart tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human colon cancer tissue, human normal colon; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14742-1-AP targets UQCRC2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, zebrafish, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6432

  Product name: Recombinant human UQCRC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 103-453 aa of BC000484

  Sequence: IEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL

• Full Name: ubiquinol-cytochrome c reductase core protein II
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC000484
• Gene Symbol: UQCRC2
• Gene ID (NCBI): 7385
• RRID: AB_2241442
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22695
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UQCRC2(Ubiquinol-cytochrome-c reductase complex core protein 2) is also named as complex III subunit 2,core protein II and belongs to the UQCRC2/QCR2 subfamily. The bc1 complex contains 11 subunits: 3 respiratory subunits (cytochrome b, cytochrome c1 and Rieske/UQCRFS1), 2 core proteins (UQCRC1/QCR1 and UQCRC2/QCR2) and 6 low-molecular weight proteins (UQCRH/QCR6, UQCRB/QCR7, UQCRQ/QCR8, UQCR10/QCR9, UQCR11/QCR10 and a cleavage product of Rieske/UQCRFS1) and is part of the mitochondrial respiratory chain. This protein distributes in mitochondrion inner membrane, peripheral membrane protein and matrix side.

Publications

What published studies show

Anti-Mitochondria Complex I (Cat# 14742-1-AP) has 152 citations across journals including Nature, Science, Cell, Cell Metabolism, Nature Communications, EMBO Journal, eLife, and Science Advances. Research fields span mitochondrial biology, oxidative phosphorylation, metabolic diseases (diabetes, obesity), neurodegeneration, cancer, immunology, cardiovascular disease, aging, and environmental toxicology.

Automatically generated from the 152 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nature; Mechanism of super-assembly of respiratory complexes III and IV.; Authors - Sara Cogliati
human	IF	Nature; Lysosomes drive the piecemeal removal of mitochondrial inner membrane; Authors - Akriti Prashar
sheep	WB	Nature; Structure and assembly of the mammalian mitochondrial supercomplex CIII2CIV.; Authors - Irene Vercellino
mouse	WB	Science; Oncometabolite d-2HG alters T cell metabolism to impair CD8+ T cell function; Authors - Giulia Notarangelo
human	WB	Cell; Mitochondrial Sirtuin Network Reveals Dynamic SIRT3-Dependent Deacetylation in Response to Membrane Depolarization.; Authors - Wen Yang
		Cell; A transmitochondrial sodium gradient controls membrane potential in mammalian mitochondria; Authors - Pablo Hernansanz-Agustín

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

One reviewer (Edward K., Nov 2022) gave a 5-star rating after using this antibody at a 1:4000 dilution for Western Blot on K562 and KCL22 cell lysates (12 µg protein). He reported that UQCRC2 detection worked well with both ECL and fluorescent secondary antibodies, producing a nice strong band.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Edward (Verified Customer) (11-15-2022)

Used with 12 ug protein lysate UQCRC2 works well, both with ECL detection and fluorescent secondary antibodies it gives a nice strong band

• Applications: Western Blot
• Primary Antibody Dilution: 1:4000
• Cell Tissue Type: K562 and KCL22