UQCRC2 Polyclonal antibody

• 

  WB analysis using 14742-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 14742-1-AP (UQCRC2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human colon using 14742-1-AP

  human colon tissue were subjected to SDS PAGE followed by western blot with 14742-1-AP (UQCRC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 14742-1-AP

  IP result of anti-UQCRC2 (IP:14742-1-AP, 4ug; Detection:14742-1-AP 1:40000) with HeLa cells lysate 1320 ug.

• 

  IHC staining of human colon cancer using 14742-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14742-1-AP (UQCRC2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 14742-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14742-1-AP (UQCRC2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human normal colon using 14742-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 14742-1-AP (UQCRC2 antibody) at dilution of 1:1200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 14742-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 14742-1-AP (UQCRC2 antibody) at dilution of 1:100 and CoraLite488-Conjugated Goat Anti-Rabbit IgG(H+L); Phalloidin stains F-actin (Red).

• 

  IF Staining of HepG2 using 14742-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 14742-1-AP (UQCRC2 antibody) at dilution of 1:100 and CoraLite488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

UQCRC2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14742-1-AP

Publications(101)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

UQCR2, Ubiquinol-cytochrome-c reductase complex core protein 2, QCR2, Cytochrome b-c1 complex subunit 2, mitochondrial, Core protein II

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human colon tissue, mouse heart tissue, rat heart tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human colon cancer tissue, human normal colon; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 91 publications below
• IHC: See 3 publications below
• IF: See 3 publications below

Product Information

14742-1-AP targets UQCRC2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, zebrafish, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6432

  Product name: Recombinant human UQCRC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 103-453 aa of BC000484

  Sequence: IEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL

• Full Name: ubiquinol-cytochrome c reductase core protein II
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC000484
• Gene Symbol: UQCRC2
• Gene ID (NCBI): 7385
• RRID: AB_2241442
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22695
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

UQCRC2(Ubiquinol-cytochrome-c reductase complex core protein 2) is also named as complex III subunit 2,core protein II and belongs to the UQCRC2/QCR2 subfamily. The bc1 complex contains 11 subunits: 3 respiratory subunits (cytochrome b, cytochrome c1 and Rieske/UQCRFS1), 2 core proteins (UQCRC1/QCR1 and UQCRC2/QCR2) and 6 low-molecular weight proteins (UQCRH/QCR6, UQCRB/QCR7, UQCRQ/QCR8, UQCR10/QCR9, UQCR11/QCR10 and a cleavage product of Rieske/UQCRFS1) and is part of the mitochondrial respiratory chain. This protein distributes in mitochondrion inner membrane, peripheral membrane protein and matrix side.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Cell; A transmitochondrial sodium gradient controls membrane potential in mammalian mitochondria; Authors - Pablo Hernansanz-Agustín
sheep	WB	Nature; Structure and assembly of the mammalian mitochondrial supercomplex CIII2CIV.; Authors - Irene Vercellino
mouse	WB	Nature; Mechanism of super-assembly of respiratory complexes III and IV.; Authors - Sara Cogliati
human	WB	Cell; Mitochondrial Sirtuin Network Reveals Dynamic SIRT3-Dependent Deacetylation in Response to Membrane Depolarization.; Authors - Wen Yang
mouse	WB	Cell Metab; Regulation of Mother-to-Offspring Transmission of mtDNA Heteroplasmy.; Authors - Ana Latorre-Pellicer
mouse	WB	Nat Cell Biol; AIDA directly connects sympathetic innervation to adaptive thermogenesis by UCP1.; Authors - Meng Shi

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Edward (Verified Customer) (11-15-2022)

Used with 12 ug protein lysate UQCRC2 works well, both with ECL detection and fluorescent secondary antibodies it gives a nice strong band

• Applications: Western Blot
• Primary Antibody Dilution: 1:4000
• Cell Tissue Type: K562 and KCL22