• Featured Product
  • KD/KO Validated

CoraLite® Plus 647-conjugated UQCRC2 Polyclonal antibody

UQCRC2 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL647-14742

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Complex III subunit 2, Core protein II, Cytochrome b-c1 complex subunit 2, mitochondrial, QCR2, Ubiquinol-cytochrome-c reductase complex core protein 2

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 647
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-14742 targets UQCRC2 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6432

Product name: Recombinant human UQCRC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 103-453 aa of BC000484

Sequence: IEAVGGKLSVTATRENMAYTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAAAYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNMRGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVKRGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKTIAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVANADIINAAKKFVSGQKSMAASGNLGHTPFVDEL

Predict reactive species
Full Name ubiquinol-cytochrome c reductase core protein II
Calculated Molecular Weight 48 kDa
Observed Molecular Weight 48 kDa
GenBank Accession NumberBC000484
Gene Symbol UQCRC2
Gene ID (NCBI) 7385
RRIDAB_2934901
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
Excitation LaserRed Laser (633 nm)
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP22695
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

UQCRC2(Ubiquinol-cytochrome-c reductase complex core protein 2) is also named as complex III subunit 2,core protein II and belongs to the UQCRC2/QCR2 subfamily. The bc1 complex contains 11 subunits: 3 respiratory subunits (cytochrome b, cytochrome c1 and Rieske/UQCRFS1), 2 core proteins (UQCRC1/QCR1 and UQCRC2/QCR2) and 6 low-molecular weight proteins (UQCRH/QCR6, UQCRB/QCR7, UQCRQ/QCR8, UQCR10/QCR9, UQCR11/QCR10 and a cleavage product of Rieske/UQCRFS1) and is part of the mitochondrial respiratory chain. This protein distributes in mitochondrion inner membrane, peripheral membrane protein and matrix side.

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 UQCRC2 antibody CL647-14742Download protocol
IF protocol for CL Plus 647 UQCRC2 antibody CL647-14742Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...