Tested Applications
Positive WB detected in | human placenta tissue, mouse heart tissue, mouse lung tissue, mouse placenta tissue, rat lung tissue |
Positive IP detected in | human placenta tissue, rat skeletal muscle tissue |
Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:8000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26415-1-AP targets VEGFR2/KDR in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig, canine, sheep |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24589 Product name: Recombinant human KDR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1158-1345 aa of BC131822 Sequence: EHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQP Predict reactive species |
Full Name | kinase insert domain receptor (a type III receptor tyrosine kinase) |
Calculated Molecular Weight | 1356 aa, 152 kDa |
Observed Molecular Weight | 150 kDa, 230 kDa |
GenBank Accession Number | BC131822 |
Gene Symbol | KDR |
Gene ID (NCBI) | 3791 |
RRID | AB_2756527 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P35968 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KDR, also named as VEGFR-2, FLK1 and CD309, is a receptor for VEGF or VEGFC. KDR which belongs to the protein kinase superfamily, has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. KDR functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. Mutations of this gene are implicated in infantile capillary hemangiomas.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for VEGFR2/KDR antibody 26415-1-AP | Download protocol |
IHC protocol for VEGFR2/KDR antibody 26415-1-AP | Download protocol |
IP protocol for VEGFR2/KDR antibody 26415-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Bioact Mater A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds | ||
Sci Bull (Beijing) Restoring sweat gland function in mice using regenerative sweat gland cells derived from chemically reprogrammed human epidermal keratinocytes | ||
J Exp Med Secretogranin III as a disease-associated ligand for antiangiogenic therapy of diabetic retinopathy. | ||
Aging Dis MSC-Derived Exosomes can Enhance the Angiogenesis of Human Brain MECs and Show Therapeutic Potential in a Mouse Model of Parkinson's Disease. | ||
J Neuroinflammation Succinate-induced macrophage polarization and RBP4 secretion promote vascular sprouting in ocular neovascularization | ||
Bioact Mater Electrochemically derived nanographene oxide activates endothelial tip cells and promotes angiogenesis by binding endogenous lysophosphatidic acid. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Poulomi (Verified Customer) (07-02-2024) | The blot was good. It detected VEGFR2 in brain endothelial cells and Hek cells.
|
FH Sammy (Verified Customer) (01-20-2024) | This works well to detect VEGFR2 in HUVEC lysate. Ab diluted in 3% BSA PBST.
|
FH Kyosuke (Verified Customer) (06-12-2019) | I am working on angiogenesis study and use this for WB on HUVECs. It works very well.
|