Tested Applications
| Positive WB detected in | human placenta tissue, mouse heart tissue, mouse lung tissue, mouse placenta tissue, rat lung tissue |
| Positive IP detected in | human placenta tissue, rat skeletal muscle tissue |
| Positive IHC detected in | human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26415-1-AP targets VEGFR2/CD309 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, canine, sheep |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24589 Product name: Recombinant human KDR protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1158-1345 aa of BC131822 Sequence: EHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQP Predict reactive species |
| Full Name | kinase insert domain receptor (a type III receptor tyrosine kinase) |
| Calculated Molecular Weight | 1356 aa, 152 kDa |
| Observed Molecular Weight | 180-200 kDa, 230 kDa |
| GenBank Accession Number | BC131822 |
| Gene Symbol | KDR |
| Gene ID (NCBI) | 3791 |
| RRID | AB_2756527 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35968 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
KDR, also named as VEGFR-2, FLK1 and CD309, is a receptor for VEGF or VEGFC. KDR which belongs to the protein kinase superfamily, has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. KDR functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. Mutations of this gene are implicated in infantile capillary hemangiomas.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for VEGFR2/CD309 antibody 26415-1-AP | Download protocol |
| IHC protocol for VEGFR2/CD309 antibody 26415-1-AP | Download protocol |
| IP protocol for VEGFR2/CD309 antibody 26415-1-AP | Download protocol |
| WB protocol for VEGFR2/CD309 antibody 26415-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The VEGFR2/CD309 Polyclonal antibody (Cat# 26415-1-AP) has accumulated 201 citations published in high-impact journals including Nature, Cell Stem Cell, Nature Communications, Science Advances, ACS Nano, Bioactive Materials, Advanced Science, Journal of Translational Medicine, Phytomedicine, and Journal of Ethnopharmacology. Research fields span angiogenesis, oncology, diabetes, stroke, wound healing, cardiovascular disease, drug discovery, tissue engineering, reproductive biology, and ophthalmology, reflecting broad utility in vascular biology and disease modeling.
| Species | Application | Title |
|---|---|---|
Exploration (Beijing) PSMA-Targeting Macrophage Membrane-Coated Nanoparticles for Precision Diagnosis and Combination Therapy of Prostate Cancer. | ||
Bioact Mater Electrochemically derived nanographene oxide activates endothelial tip cells and promotes angiogenesis by binding endogenous lysophosphatidic acid. | ||
Bioact Mater Bioactive vascular buds promote collateral vessel formation by grafting on the artificial vessel walls | ||
Bioact Mater A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds | ||
Cell Stem Cell Modeling blood-brain barrier formation and cerebral cavernous malformations in human PSC-derived organoids |
Reviews
What customers say
All three reviews are for Western Blot applications, with ratings of 4–5 stars. Users report reliable detection of VEGFR2 in HUVEC and brain endothelial cell lysates. Recommended dilutions range from 1:1000 to 1:3000, with one user noting successful use in 3% BSA PBST. The antibody is praised for its performance in angiogenesis studies, with no reported issues across different lots or cell types.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Poulomi (Verified Customer) (07-02-2024) | The blot was good. It detected VEGFR2 in brain endothelial cells and Hek cells.
|
Sammy (Verified Customer) (01-20-2024) | This works well to detect VEGFR2 in HUVEC lysate. Ab diluted in 3% BSA PBST.
|
Kyosuke (Verified Customer) (06-12-2019) | I am working on angiogenesis study and use this for WB on HUVECs. It works very well.
|
