• Featured Product
  • KD/KO Validated

VEGFR2/KDR Polyclonal antibody

VEGFR2/KDR Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 26415-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (3)

Applications

WB, IHC, IF, IP, CoIP, ELISA

KDR, VEGFR2, Vascular endothelial growth factor receptor 2, Protein-tyrosine kinase receptor flk-1, FLK-1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman placenta tissue, mouse heart tissue, mouse lung tissue, mouse placenta tissue, rat lung tissue
Positive IP detected inhuman placenta tissue, rat skeletal muscle tissue
Positive IHC detected inhuman placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26415-1-AP targets VEGFR2/KDR in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, canine, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag24589

Product name: Recombinant human KDR protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1158-1345 aa of BC131822

Sequence: EHLGNLLQANAQQDGKDYIVLPISETLSMEEDSGLSLPTSPVSCMEEEEVCDPKFHYDNTAGISQYLQNSKRKSRPVSVKTFEDIPLEEPEVKVIPDDNQTDSGMVLASEELKTLEDRTKLSPSFGGMVPSKSRESVASEGSNQTSGYQSGYHSDDTDTTVYSSEEAELLKLIEIGVQTGSTAQILQP

Predict reactive species
Full Name kinase insert domain receptor (a type III receptor tyrosine kinase)
Calculated Molecular Weight 1356 aa, 152 kDa
Observed Molecular Weight150 kDa, 230 kDa
GenBank Accession NumberBC131822
Gene Symbol KDR
Gene ID (NCBI) 3791
RRIDAB_2756527
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP35968
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

KDR, also named as VEGFR-2, FLK1 and CD309, is a receptor for VEGF or VEGFC. KDR which belongs to the protein kinase superfamily, has a tyrosine-protein kinase activity. The VEGF-kinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability. In case of HIV-1 infection, the interaction with extracellular viral Tat protein seems to enhance angiogenesis in Kaposi's sarcoma lesions. KDR functions as the main mediator of VEGF-induced endothelial proliferation, survival, migration, tubular morphogenesis and sprouting. Mutations of this gene are implicated in infantile capillary hemangiomas.

Protocols

Product Specific Protocols
WB protocol for VEGFR2/KDR antibody 26415-1-APDownload protocol
IHC protocol for VEGFR2/KDR antibody 26415-1-APDownload protocol
IP protocol for VEGFR2/KDR antibody 26415-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Bioact Mater

A bioactive composite hydrogel dressing that promotes healing of both acute and chronic diabetic skin wounds

Authors - Shunlai Shang
humanIF

Sci Bull (Beijing)

Restoring sweat gland function in mice using regenerative sweat gland cells derived from chemically reprogrammed human epidermal keratinocytes

Authors - Jiangbing Xiang
mouseWB

J Exp Med

Secretogranin III as a disease-associated ligand for antiangiogenic therapy of diabetic retinopathy.

Authors - Michelle E LeBlanc
humanWB,IHC

Aging Dis

MSC-Derived Exosomes can Enhance the Angiogenesis of Human Brain MECs and Show Therapeutic Potential in a Mouse Model of Parkinson's Disease.

Authors - Chunling Xue
WB,IF

J Neuroinflammation

Succinate-induced macrophage polarization and RBP4 secretion promote vascular sprouting in ocular neovascularization

Authors - Tianyi Shen
humanWB

Bioact Mater

Electrochemically derived nanographene oxide activates endothelial tip cells and promotes angiogenesis by binding endogenous lysophosphatidic acid.

Authors - Wenjing Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Poulomi (Verified Customer) (07-02-2024)

The blot was good. It detected VEGFR2 in brain endothelial cells and Hek cells.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: Endothelial Cells
FH

Sammy (Verified Customer) (01-20-2024)

This works well to detect VEGFR2 in HUVEC lysate. Ab diluted in 3% BSA PBST.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 in 1000
  • Cell Tissue Type: HUVEC
FH

Kyosuke (Verified Customer) (06-12-2019)

I am working on angiogenesis study and use this for WB on HUVECs. It works very well.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HUVECs
Loading...