Tested Applications
Positive WB detected in | unboiled mouse brain tissue |
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse brain tissue |
Positive IF-Fro detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Immunofluorescence (IF)-FRO | IF-FRO : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
29209-1-AP targets VGLUT2 in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29565 Product name: Recombinant human SLC17A6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 499-582 aa of NM_020346 Sequence: SGEKQPWADPEETSEEKCGFIHEDELDEETGDITQNYINYGTTKSYGATTQANGGWPSGWEKKEEFVQGEVQDSHSYKDRVDYS Predict reactive species |
Full Name | solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 6 |
Calculated Molecular Weight | 64 kDa |
Observed Molecular Weight | 60-70 kDa |
GenBank Accession Number | NM_020346 |
Gene Symbol | VGLUT2 |
Gene ID (NCBI) | 57084 |
RRID | AB_3086104 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9P2U8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
VGLUT2, also known as SLC17A6, belongs to the major facilitator superfamily. VGLUT2 is a multifunctional transporter that transports phosphate at the plasma membrane and glutamate in synaptic vesicles (PMID:33440152, 11432869). VGLUT2 is involved in neurotransmitter loading into synaptic vesicles (PMID: 11698620). VGLUT2 is predominantly expressed in adult and fetal brain, with highest expression in the medulla, substantia nigra, subthalamic nucleus, and thalamus, and low levels in the cerebellum and hippocampus (PMID:10820226).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for VGLUT2 antibody 29209-1-AP | Download protocol |
IHC protocol for VGLUT2 antibody 29209-1-AP | Download protocol |
IF protocol for VGLUT2 antibody 29209-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |